KEGG   Nitrosococcus oceani: Noc_1255Help
Entry
Noc_1255          CDS       T00281                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide acyltransferase (E2) component-like enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
noc  Nitrosococcus oceani
Pathway
noc00010  Glycolysis / Gluconeogenesis
noc00020  Citrate cycle (TCA cycle)
noc00620  Pyruvate metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
Module
noc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_1255
   00020 Citrate cycle (TCA cycle)
    Noc_1255
   00620 Pyruvate metabolism
    Noc_1255
Enzymes [BR:noc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Noc_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABA57756
JGI: Noc1255
UniProt: Q3JBP0
Position
1381166..1382509
Genome map
AA seq 447 aa AA seqDB search
MAREFKLPELGENIESGDVAKVLVSPGDTLEKDQPVLELETDKAVVEIPSTASGKIKELK
VKAGDQVAIGQVILTLEEGGEEAQEDVPAAREEPKPEQEHKPPEKSAAATGHQQPTTDVS
PIEARGEGGTEREKIPDYEATSSAPAPATPSVRRLARELGVDIHEVAGSGPGGRISGDDV
KHYVRALISQRPAPSASAVVSRASPSLPLPSFEKWGSVEREPMSRVRRKTAEQMSQAWTI
PHVTQHDQADITRLEQARKRFAKRVEQAGGKLTLTAIALKVAAAALQAFPRFNTSIDVDA
KELVYKQYCHIGVAVDAEHGLLVPVIREADQKNIAQLAVELTELAEKARSRKIGPEEMAG
GSFTITNLGGLGGSYFTPIINWPEVAILGLSRAKMAPLYIEGEFQPRLLLPLSLSYDHRV
IDGADAVRFLRWIVEALEDPLLLSLEG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgtgaattcaagcttccggaattgggcgagaacattgaatctggcgatgtggcc
aaagtgctggtgtctccgggagataccctggaaaaagatcagccagtattagagcttgaa
accgacaaggccgtggtggagatcccttcaacggccagcggtaaaattaaggagctaaag
gttaaagcgggagatcaagtagcaatcggccaggttattcttaccttggaagaaggagga
gaagaggcccaggaggatgtccccgctgctagagaagagccgaagcccgaacaggaacac
aaaccccctgaaaaaagcgcggctgcaacaggtcaccagcagccgacaacagatgtttct
ccgatagaggctcgtggggagggaggaacggagcgagaaaaaattccggactatgaggcg
acatcctcggcgcctgccccggcaaccccgtcggtacgccggctggcccgggaactcggc
gttgatattcatgaggttgcagggtctggcccgggtgggcggatttctggggatgatgtc
aaacattatgtccgtgccttgatatcacaacggcctgccccctcggcgtcggcggtggtt
tctcgggcgagcccttccctccctttgccttcgtttgaaaaatggggttcggtggagcgg
gagcccatgagcagggttcgccgcaagacagcagagcaaatgagccaagcctggactatt
ccccatgtgacccagcatgatcaggcggatatcacccggcttgaacaagcccggaagcgt
tttgccaagcgggtagagcaagcaggcggcaagctcaccctgaccgctattgccttgaag
gtggctgccgctgcgctacaagcttttccccgctttaatacatccatagatgtggacgct
aaagagttggtctataaacagtattgtcatattggcgtggcggtggatgcggaacatggc
ctgttggtacctgtcattagggaggccgatcaaaaaaacatcgcccaattagcggtagag
ctgacggagcttgccgagaaggcaagaagccgaaaaatcggtcccgaggaaatggcagga
ggctcttttaccattaccaacttgggtggtttaggcggctcttattttacccccattatt
aattggccggaggtcgctattttgggtctctcccgagctaaaatggctcctctttacata
gaaggggaatttcagccccggctgcttctgcccctctctctgtcttatgatcatcgggtc
attgatggcgctgatgcagtacgctttctacgctggattgtggaggcgctagaagatcct
ctcctgttgtccttggagggatag

DBGET integrated database retrieval system