KEGG   Nitrosococcus oceani: Noc_1255Help
Entry
Noc_1255          CDS       T00281                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
noc  Nitrosococcus oceani
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_1255
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_1255
   00020 Citrate cycle (TCA cycle)
    Noc_1255
   00620 Pyruvate metabolism
    Noc_1255
Enzymes [BR:noc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Noc_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1381166..1382509
Genome map
AA seq 447 aa AA seqDB search
MAREFKLPELGENIESGDVAKVLVSPGDTLEKDQPVLELETDKAVVEIPSTASGKIKELK
VKAGDQVAIGQVILTLEEGGEEAQEDVPAAREEPKPEQEHKPPEKSAAATGHQQPTTDVS
PIEARGEGGTEREKIPDYEATSSAPAPATPSVRRLARELGVDIHEVAGSGPGGRISGDDV
KHYVRALISQRPAPSASAVVSRASPSLPLPSFEKWGSVEREPMSRVRRKTAEQMSQAWTI
PHVTQHDQADITRLEQARKRFAKRVEQAGGKLTLTAIALKVAAAALQAFPRFNTSIDVDA
KELVYKQYCHIGVAVDAEHGLLVPVIREADQKNIAQLAVELTELAEKARSRKIGPEEMAG
GSFTITNLGGLGGSYFTPIINWPEVAILGLSRAKMAPLYIEGEFQPRLLLPLSLSYDHRV
IDGADAVRFLRWIVEALEDPLLLSLEG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgtgaattcaagcttccggaattgggcgagaacattgaatctggcgatgtggcc
aaagtgctggtgtctccgggagataccctggaaaaagatcagccagtattagagcttgaa
accgacaaggccgtggtggagatcccttcaacggccagcggtaaaattaaggagctaaag
gttaaagcgggagatcaagtagcaatcggccaggttattcttaccttggaagaaggagga
gaagaggcccaggaggatgtccccgctgctagagaagagccgaagcccgaacaggaacac
aaaccccctgaaaaaagcgcggctgcaacaggtcaccagcagccgacaacagatgtttct
ccgatagaggctcgtggggagggaggaacggagcgagaaaaaattccggactatgaggcg
acatcctcggcgcctgccccggcaaccccgtcggtacgccggctggcccgggaactcggc
gttgatattcatgaggttgcagggtctggcccgggtgggcggatttctggggatgatgtc
aaacattatgtccgtgccttgatatcacaacggcctgccccctcggcgtcggcggtggtt
tctcgggcgagcccttccctccctttgccttcgtttgaaaaatggggttcggtggagcgg
gagcccatgagcagggttcgccgcaagacagcagagcaaatgagccaagcctggactatt
ccccatgtgacccagcatgatcaggcggatatcacccggcttgaacaagcccggaagcgt
tttgccaagcgggtagagcaagcaggcggcaagctcaccctgaccgctattgccttgaag
gtggctgccgctgcgctacaagcttttccccgctttaatacatccatagatgtggacgct
aaagagttggtctataaacagtattgtcatattggcgtggcggtggatgcggaacatggc
ctgttggtacctgtcattagggaggccgatcaaaaaaacatcgcccaattagcggtagag
ctgacggagcttgccgagaaggcaagaagccgaaaaatcggtcccgaggaaatggcagga
ggctcttttaccattaccaacttgggtggtttaggcggctcttattttacccccattatt
aattggccggaggtcgctattttgggtctctcccgagctaaaatggctcctctttacata
gaaggggaatttcagccccggctgcttctgcccctctctctgtcttatgatcatcgggtc
attgatggcgctgatgcagtacgctttctacgctggattgtggaggcgctagaagatcct
ctcctgttgtccttggagggatag

DBGET integrated database retrieval system