KEGG   Nitrosococcus oceani: Noc_1390Help
Entry
Noc_1390          CDS       T00281                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
noc  Nitrosococcus oceani
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:noc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1540323..1540964
Genome map
AA seq 213 aa AA seqDB search
MDTKLTKVVREGRYIGSLDVKPGEHYDPEFEASVEEILTRLGEDPKREGLKRTPQRVAKA
LDFLTSGYHMTVEEVVKDALFEDECEEMVIVKDVEFYSLCEHHMLPFFGRAHVGYLPKGR
IVGLSKIARVIDVFARRLQVQERLTTQIASGLMAVLNARGVGVVLEACHFCMVMRGVQKQ
NSQTVTSAMLGTFREDSRTRAEFMELIRRSSVS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggatacgaaattgaccaaggtggtgcgggaaggccgctacattggcagcctggatgtg
aagccgggggagcattatgacccggaattcgaagccagcgtggaggaaattttaacccgc
ttgggcgaagatcccaaacgtgagggacttaaacgtactccacagcgagttgctaaagcc
cttgattttcttacgagtggttatcatatgacggtggaagaggtggtcaaggatgccctc
tttgaggatgaatgcgaggaaatggttattgtcaaggatgtggaattctattctctgtgt
gagcatcacatgctgccttttttcggacgggcccatgtgggctacctgccgaagggacgc
attgtggggctgagtaaaatcgcccgggtgattgatgtctttgcccggcggctccaggtg
caagaacgcctcaccactcaaattgcgagtgggttaatggcagtacttaatgcccgcggc
gttggcgttgttttggaagcttgtcatttttgtatggtcatgcgaggcgtgcagaaacag
aatagccagacggttaccagtgctatgttggggacatttcgcgaggactcacggactcgg
gccgagtttatggagttaatacgccgttcctcggtcagttaa

DBGET integrated database retrieval system