KEGG   Nitrosococcus oceani: Noc_1395Help
Entry
Noc_1395          CDS       T00281                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
noc  Nitrosococcus oceani
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_1395
   01230 Biosynthesis of amino acids
    Noc_1395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_1395
  Energy metabolism
   00680 Methane metabolism
    Noc_1395
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noc_1395
Enzymes [BR:noc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Noc_1395
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Noc_1395
  Exosomal proteins of melanoma cells
   Noc_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1546026..1546748
Genome map
AA seq 240 aa AA seqDB search
MILLRHGESVWNLENRFTGWTDVDLSANGVEEARLAGKILKNEGYQFDKAYTSVLKRAIR
TLWIVEEMMDLVWLPVEKRWELNERHYGNLQGLNKAEMAKQYGAELVHQWRRGYGIEPPP
LDNSDPRHPRFDRRYAGLAPEALPASESLKKTLKRVIPCWKQHILPDIAAGKELIIVAHG
NSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDSAFRPTAHYYLADSEKSQVVIGDTAH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgatattacttcgtcatggtgaaagcgtgtggaatttggagaatcggttcaccggttgg
acggatgtcgatctttccgcaaatggcgttgaagaagcccgtcttgcaggtaagattttg
aaaaatgaagggtatcaattcgataaggcctatacgtcggtacttaagcgggctattcgt
accctctggatcgtagaagaaatgatggatctggtatggctccctgtggagaaacggtgg
gagctaaatgagcgtcactatggcaacctgcaagggttgaacaaagcagaaatggctaag
caatatggtgcggagctagtgcatcagtggcgccggggttatggaatagagccaccgcca
ttggataattctgatccacggcacccacgcttcgataggcgttatgcaggtttggctcct
gaagcgttgccagcatcagaatcccttaaaaaaacccttaagcgggttattccatgttgg
aagcaacacatcttaccggatattgctgctggcaaggagttgattattgttgcccacggt
aattccttgcgggctttatataaacatcttgagggattatctgatcaggaggtgatggag
cttaatattcctacgggtattcccttggtgttcgagttagacagtgctttcaggccaacc
gcccattattatttagctgattctgaaaagagtcaggtggtgatcggcgataccgcccat
tag

DBGET integrated database retrieval system