KEGG   Nitrosococcus oceani: Noc_1395Help
Entry
Noc_1395          CDS       T00281                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
noc  Nitrosococcus oceani
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_1395
   01230 Biosynthesis of amino acids
    Noc_1395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_1395
  Energy metabolism
   00680 Methane metabolism
    Noc_1395
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noc_1395
Enzymes [BR:noc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Noc_1395
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Noc_1395
  Exosomal proteins of melanoma cells
   Noc_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1546026..1546748
Genome map
AA seq 240 aa AA seqDB search
MILLRHGESVWNLENRFTGWTDVDLSANGVEEARLAGKILKNEGYQFDKAYTSVLKRAIR
TLWIVEEMMDLVWLPVEKRWELNERHYGNLQGLNKAEMAKQYGAELVHQWRRGYGIEPPP
LDNSDPRHPRFDRRYAGLAPEALPASESLKKTLKRVIPCWKQHILPDIAAGKELIIVAHG
NSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDSAFRPTAHYYLADSEKSQVVIGDTAH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgatattacttcgtcatggtgaaagcgtgtggaatttggagaatcggttcaccggttgg
acggatgtcgatctttccgcaaatggcgttgaagaagcccgtcttgcaggtaagattttg
aaaaatgaagggtatcaattcgataaggcctatacgtcggtacttaagcgggctattcgt
accctctggatcgtagaagaaatgatggatctggtatggctccctgtggagaaacggtgg
gagctaaatgagcgtcactatggcaacctgcaagggttgaacaaagcagaaatggctaag
caatatggtgcggagctagtgcatcagtggcgccggggttatggaatagagccaccgcca
ttggataattctgatccacggcacccacgcttcgataggcgttatgcaggtttggctcct
gaagcgttgccagcatcagaatcccttaaaaaaacccttaagcgggttattccatgttgg
aagcaacacatcttaccggatattgctgctggcaaggagttgattattgttgcccacggt
aattccttgcgggctttatataaacatcttgagggattatctgatcaggaggtgatggag
cttaatattcctacgggtattcccttggtgttcgagttagacagtgctttcaggccaacc
gcccattattatttagctgattctgaaaagagtcaggtggtgatcggcgataccgcccat
tag

DBGET integrated database retrieval system