KEGG   Nitrosococcus oceani: Noc_1586Help
Entry
Noc_1586          CDS       T00281                                 

Definition
flavodoxin reductase (ferredoxin-NADPH reductase) family protein 1 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
noc  Nitrosococcus oceani
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Noc_1586
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Noc_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1766751..1767416)
Genome map
AA seq 221 aa AA seqDB search
MTYTVTLLMAEFVTHDVKRFIVSRPPGFDYQPGQGVELAINQPEWKDQGRPFTPTSLGED
KVLEFTIKRYSDHHGVTEKLHTLLPGEELLMSDPFGTITYQGTGVFIAGGAGITPFMAII
RQLSHQDKLANHTLIFSNKTPADIICEKEFRHYFNEKCILTCTETSAPGYDDQLITGEFL
QQNIADFNQQFYTCGPPQFTKDINNALVELGANPNALVFEK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacttataccgtgactttattaatggcggaattcgttacgcatgatgtcaagcgcttt
atcgtgagccggccacccggctttgactaccaacctggccaaggtgttgagttggctatt
aatcaacccgagtggaaagaccaggggcggccctttacccccacctccctcggggaagat
aaagtgctggaattcactatcaagagatattccgaccaccacggtgtaaccgaaaaactg
catactttgctgccaggcgaagaactactcatgtcagatcccttcggcaccattacctat
cagggaacgggagtttttatcgccggcggagccggaatcactccctttatggctatcatt
cgccagctctcccaccaagataaactcgccaatcacaccttgatcttttccaacaaaacg
ccagcagatattatttgcgaaaaggaattccgtcattactttaatgaaaaatgtattttg
acctgtaccgaaaccagcgctccaggctacgacgatcaattgattaccggagaatttttg
caacaaaatatcgctgactttaatcagcagttttacacgtgcggcccgccccagtttaca
aaagatatcaataatgctttggttgaacttggcgctaaccctaatgcgttggtgtttgaa
aaataa

DBGET integrated database retrieval system