KEGG   Nitrosococcus oceani: Noc_1601Help
Entry
Noc_1601          CDS       T00281                                 

Definition
chemotaxis protein CheB (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
noc  Nitrosococcus oceani
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:noc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Noc_1601
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Noc_1601
Enzymes [BR:noc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Noc_1601
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Noc_1601
Two-component system [BR:noc02022]
 CheA family
  CheA-CheYBV
   Noc_1601
Bacterial motility proteins [BR:noc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Noc_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1781006..1784674)
Genome map
AA seq 1222 aa AA seqDB search
MRLKKPDSPPFSIVGIGASAGGIEALETFFEALPEKMGVAFVVIIHLDPEYRSELASILA
RKTPMPVEEVQGNCALEPNHVYVISPNQQLELTDSHIGAFPFEQPQGQRAPIDTFFRSLA
KQYGDGFAIILSGSGSDGAVGVKAIKEQGGLILVQLPTEARFDGMPRAAMATGIVDFVLP
TRQLAQRLPELIEGKRHIYEKLADETQIQNKDSLLKSIFAHLQRKQGYDFSKYKRPTILR
RLARRMQIQHQRTLNDYLNFLRQTPEESQALFEEFLVSVTAFFRDPEAWETLSKQIIPRL
FEEKAADTPLRAWVPGCATGEEAYTLAILLLEEAGRRGVPPTDIQIFATDLDKGALATAR
AGYYPSAIKADLTDARLRRYFRAEGNHYRLIGEVRDCVLFAVHSLLQAPPFSRLDLISCR
NLLIYLDQDLQDQAFDIMHYGLRRGGYLFLGNAESAEGENFRTIEPSHYLFQAQQTLGQR
PPIPSLFAVPDRTRTLIPLSESPVPTSAHVHRQLLEEFAPPSLLVNERHQVLHLSNNVGR
FLQPAGGSPSQEIMTLVRPALQAALSMALYHAFEKNKPSLSPFTPIPFNGTPRQVAVLAQ
PRRAAADQEKIALVIFLEGDEESSSVEQALSEETASFPLAHHLQEELQQARMQLHARQKQ
AETDSENLRAANEELQSLNEEYRSTAEELETSKEELQSINEELHTVNNELKTKLEETSRA
RSDMENLLASTGIGTLFLDRQLNIHRFTPPVTKLFPITTHDYGRPITDFTDRLTYNQFEA
DTRRVLHTLMPIERELRHQQGPWYLVRIHPYRNPEEDVIGLIVTFVDISHRKENEERQQH
LTQKLSQQTKRLQAQDRQKDEFLALLGHELRNPLAVIFNTTELLIRESGATRDAQHGIAL
IGRQAKHLGRLVDDLLNLTRVNSGQIKLNKTTLELRDSITDAIDQTRPQIEWGRHQLAVD
LPASPLYLEADSERLTQIIANLLSNAAHYTKPEGNITVTARQVEEQILIQVRDTGIGFAP
EQLPQLFQPFDRLPSAVAHHRSGLGLGLNLARRLAELHQGSLEGFSAGPGQGSEFTLRLP
ALPGEQTGPPTPQEVLPEAETTTPPRRILLVEDDEAVADSLAMLLRLQGHEVQTICRGNQ
TFNAVLKFYPEVVLLDIGLPDMDGYQVAQRLRQEPGLETLPLVALTGYGQDNDVQRAKAA
GFNRHLLKPVTIETLQEVLREL
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttaaaaagccggattctccaccattctccattgtgggcatcggcgcctccgcc
ggcggcatcgaagccttagagacattctttgaagccctgcccgagaagatgggagtcgcc
tttgtagtcattattcaccttgacccggagtaccgcagcgagctagcgtccatcctcgcc
cggaagacccccatgccggtggaggaagtgcagggcaactgcgcgcttgagccgaaccat
gtctatgtcatttctcccaaccaacaactcgagcttacggacagccatataggcgccttc
cccttcgagcaaccgcagggacaacgagcgcctattgatacgttcttccgttcactggcc
aagcaatacggcgacggcttcgctattattctctccggcagcggctcggacggcgctgtc
ggcgtcaaggccatcaaggagcaagggggccttatcctggtgcaactccccaccgaggcc
cgcttcgacggcatgccccgggccgccatggccaccgggatagtcgacttcgtgcttccc
acgcggcaattggcccagcgtctgcccgagctgattgaaggtaagcgccatatttacgaa
aaactcgcggacgagacgcagattcagaacaaggattctctactcaagagcatctttgcc
catctgcaaaggaagcaaggctatgatttttctaagtataaacgccccaccatactgcgc
cgcttggcccgccggatgcaaatccagcaccagcggaccctgaacgactaccttaatttt
ctccgccaaactccggaagagtcccaggccctctttgaagaattcctagtctcggtcacc
gccttcttccgggacccggaagcgtgggaaacgctcagcaagcagatcatcccccggcta
ttcgaggaaaaagcggcggacaccccgctgcgggcctgggtgcccggttgcgccacaggc
gaggaagcctacaccctggcgattctgctgctggaagaagccgggcggcggggggtgccg
cccaccgatatccaaatctttgccaccgacttggacaaaggggccctggccacagctcga
gcaggttactacccctccgccatcaaggccgatctcaccgatgcacgcctgcgccggtac
ttccgggcggaaggcaaccactaccgcctcataggggaagtccgtgactgtgttctcttt
gccgtccacagcctgttgcaggccccccccttctcccgtctcgacctcatctcttgccgt
aatctgctgatctatctcgaccaggacttgcaggaccaggcctttgatatcatgcactac
gggctgcgccgagggggctacctctttctcggcaacgccgagagcgccgagggggaaaac
tttcggaccatcgagccatcccattatctcttccaagcgcagcaaactctgggccaaagg
ccgccgatcccctctctatttgccgtgcctgaccggactcggacacttattccattgtcc
gagtctccggtccctacctccgcccatgtccaccgccaactcctggaagaattcgccccc
cccagtctcctggtgaacgagcgccaccaggtgctccatctctcgaataacgtggggcgt
ttcctccagcccgctggcggatctcctagccaggagatcatgacgctggtgcgcccggcc
ctgcaagccgccctaagcatggccctctaccatgccttcgaaaagaacaagcccagcctc
tcccccttcacgcccatccccttcaacggaacaccccggcaggtggcggtcctagcgcag
ccccgacgggcggcggcggaccaggaaaaaatcgccctggtgatattcctggagggggat
gaggagtcgtcttccgtggaacaagccctatccgaggagaccgcatcgttccccctggcg
caccatctccaggaggagttgcagcaagcacgcatgcaactccacgcgagacagaagcag
gccgaaacggacagcgaaaatctccgggcggccaacgaagaactccaaagcctcaacgag
gaataccgctccaccgccgaggagctagaaaccagtaaagaggaacttcaaagtatcaat
gaggagctccatacggtcaataacgagctcaagaccaaacttgaggaaacctcccgggcc
cgcagtgatatggaaaacctcctggcctccacgggaatcggcaccctgtttctcgaccgc
caattgaatatccaccgcttcacgccgccggtcaccaagctgttccccatcactacccac
gattacggccggcccattaccgatttcactgatcgccttacctacaaccagttcgaagcg
gacactcgccgcgtgctgcatactcttatgcccatcgagcgggaactcagacaccagcaa
ggaccctggtacctggtacgcatccatccctatcgaaacccggaggaggatgttattggc
ctgatcgtcaccttcgtggatatttcccaccgcaaggaaaacgaggagaggcaacagcac
ctcacccagaaattgagccaacaaaccaagcggttgcaagcacaagaccgacaaaaagac
gagtttctcgccctattagggcacgaactgcgcaatcccttagcagtcattttcaataca
accgaactactcatccgggagagcggggcaacccgcgatgcccagcatgggatcgccctt
atcggccgtcaggcaaaacacctggggcgcttggtggatgatctgttaaatctgacccgc
gtcaatagcggccaaattaaactaaataaaacgaccctggaattgcgggacagcatcacg
gacgccattgaccagacgcgcccgcagatcgagtggggccgccatcaactggcagtggat
ttgcccgcctcccccctctacctagaggcggactcggagcgactgacccaaatcatagcc
aatttattgagcaacgcggcccactacaccaagccagaaggcaacattacggtcacggcg
cgccaggtggaggaacaaatccttatccaggtgcgggataccgggatcggattcgcccca
gagcagttgccgcaactgttccaacccttcgaccgcttgccatccgctgtcgctcatcac
cgctcgggcctgggcctgggcctgaacctggcccgcaggctggcggaactccaccagggc
agcttggagggattcagtgccggccctggtcagggcagtgaattcacgttgcgtttaccg
gccctgccgggggaacaaaccggcccgccgaccccacaggaggtcctcccggaggctgaa
accacaaccccgccccgccgcatcctgctggttgaggacgacgaagcggtggccgattcc
ctggcgatgttgctgcggctccaaggccatgaggtgcagactatctgccggggcaaccag
acctttaacgcggtgctcaagttctacccggaggtggtgcttctggatattggtctacca
gatatggatggctatcaggtcgcccagcggctgcgccaggaaccgggcctggaaactctt
cctctggtggccctgaccggctacggccaggataatgacgtgcaacgggccaaggcggcc
ggctttaatcgtcatctcctcaaaccagtcaccatagaaaccttacaagaagtcttgcgg
gaactttga

DBGET integrated database retrieval system