KEGG   Nitrosococcus oceani: Noc_1681Help
Entry
Noc_1681          CDS       T00281                                 

Definition
alpha amylase (EC:3.2.1.141)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
noc  Nitrosococcus oceani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:noc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1875794..1877641)
Genome map
AA seq 615 aa AA seqDB search
MQHCHGMPFGAEVTEKGTVRFRLWAPAAKQVELCLEDTLEVVPLAMTPKEEGWFELETKE
AGPGSLYCYQINGGMRVPDPASRFQPQDIHGPSEVVDPATFKWQEEGWNGRPWEEAVIYE
IHVGTFTPEGTFRGLESHLEHLAKLGVTALELMPVADFPGRWNWGYDGVSLFAPDSRYGR
PHDLKSLVQAAHACGLMIFLDVVYNHFGPEGNYLHQYAPDFFTERHQTPWGAAINFDGKN
AHWVRQFFIHNALFWLEEYQFDGLRLDAVHAIQDDSKFHILEELAETIFCHLDSRRRIHL
VLENDNNIARYLTRKPNGQPRWYTAQWNDDIHHALHVLTTQETTGYYLDYADQPIAHLGR
CLSEGFGYQGQHSPYREGKPRGEPSKILPPSAFVTFFQNHDQVGNRAFGERITALITPEE
VKALTALLLLSPFPPLLFMGQEWGSTQPFPFFCDFSEDLAASVREGRRREFAHFPEFNNP
AAQERIPDPTAQATFDNAVLNWTHATNGKGKEWFELHQNLLKLRRQWIIPRLAAMRKNNG
CYIPLGKQALQVRWQLGDGAQLTILANLGKISIFLSTLPSGEVLFTTFSDLNRILIHKNL
PPKTVIWFLKENSSD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcagcactgccatggtatgccttttggcgctgaagtgacagaaaaaggtaccgtgcgt
tttcggttatgggcgcctgccgctaagcaagtggagttatgcttggaggatacgctagaa
gtagtccccttagctatgactcctaaagaagagggttggtttgagctagaaactaaagag
gctggtccgggcagtttatactgctatcagatcaatggtgggatgcgggttcctgatccc
gcttctcgatttcagccccaagatatccacggtcccagcgaggtggttgatccagctact
tttaaatggcaggaagagggatggaatggacgaccttgggaagaggccgttatttatgaa
atccatgtaggaacttttaccccagagggtacttttcgaggattggagagtcacctggag
catctagcaaaattaggggtaaccgcattggaactgatgccggttgccgatttccctggc
cgttggaattggggttacgatggtgtttccttgtttgcaccagatagccgttatggtcgg
ccccacgatctcaaatcccttgtgcaagctgcccatgcttgtggattaatgatattttta
gacgtggtgtataatcatttcggtccggaaggcaactatctccatcaatatgccccagac
ttttttacagaacgccaccaaactccatggggggcagctatcaattttgatgggaagaat
gcccattgggtccggcagttttttatccataatgctctcttctggctggaggaataccaa
tttgatggccttcggttggatgcggttcatgcgattcaagatgattctaagttccatatt
cttgaagagttggcagagacgattttctgccatctagattccaggcggcgtatacatctg
gtgctagaaaatgataataatatagcccgttaccttacccggaagcctaacggacaaccc
cgttggtacactgcgcaatggaatgatgatatccaccatgccttgcatgtactcaccact
caggaaactacaggttattacttagactatgccgatcagcctattgctcatctaggccgt
tgtttgagcgaaggttttggttatcaagggcaacattctccttacagggaaggcaaaccc
cgtggcgagcctagcaagattttaccgccaagcgcttttgtaaccttctttcaaaaccac
gatcaagtgggtaacagggctttcggtgagcgaataacggctttaataacacctgaagaa
gtgaaggcattaaccgcgttgctattgctctctcctttcccgccccttttatttatgggc
caggagtggggatcaactcaaccctttccttttttttgcgattttagtgaggatttggct
gcaagtgttcgggagggtcggcgaagggaattcgcccattttcctgaattcaataatcca
gcggcccaagaacgaattccggatcctaccgctcaggcgacctttgacaatgctgtttta
aactggactcacgcaaccaatggaaaagggaaagaatggtttgagttacatcaaaatctg
ctaaaactacggcgccaatggatcattcccaggctagctgctatgagaaaaaacaacggt
tgttatatacccttaggtaagcaggcactacaagttcggtggcaattaggcgatggggca
caattaacaatattagctaacttaggaaaaatttctattttcttatcgactctcccttcc
ggagaagtactttttaccaccttttcagatttaaataggatacttatccacaaaaatctg
ccccctaagacggtaatttggtttctcaaagagaattccagtgattga

DBGET integrated database retrieval system