KEGG   Nitrosococcus oceani: Noc_1681Help
Entry
Noc_1681          CDS       T00281                                 

Definition
alpha amylase (EC:3.2.1.141)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
noc  Nitrosococcus oceani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Noc_1681
Enzymes [BR:noc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Noc_1681
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Noc_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1875794..1877641)
Genome map
AA seq 615 aa AA seqDB search
MQHCHGMPFGAEVTEKGTVRFRLWAPAAKQVELCLEDTLEVVPLAMTPKEEGWFELETKE
AGPGSLYCYQINGGMRVPDPASRFQPQDIHGPSEVVDPATFKWQEEGWNGRPWEEAVIYE
IHVGTFTPEGTFRGLESHLEHLAKLGVTALELMPVADFPGRWNWGYDGVSLFAPDSRYGR
PHDLKSLVQAAHACGLMIFLDVVYNHFGPEGNYLHQYAPDFFTERHQTPWGAAINFDGKN
AHWVRQFFIHNALFWLEEYQFDGLRLDAVHAIQDDSKFHILEELAETIFCHLDSRRRIHL
VLENDNNIARYLTRKPNGQPRWYTAQWNDDIHHALHVLTTQETTGYYLDYADQPIAHLGR
CLSEGFGYQGQHSPYREGKPRGEPSKILPPSAFVTFFQNHDQVGNRAFGERITALITPEE
VKALTALLLLSPFPPLLFMGQEWGSTQPFPFFCDFSEDLAASVREGRRREFAHFPEFNNP
AAQERIPDPTAQATFDNAVLNWTHATNGKGKEWFELHQNLLKLRRQWIIPRLAAMRKNNG
CYIPLGKQALQVRWQLGDGAQLTILANLGKISIFLSTLPSGEVLFTTFSDLNRILIHKNL
PPKTVIWFLKENSSD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcagcactgccatggtatgccttttggcgctgaagtgacagaaaaaggtaccgtgcgt
tttcggttatgggcgcctgccgctaagcaagtggagttatgcttggaggatacgctagaa
gtagtccccttagctatgactcctaaagaagagggttggtttgagctagaaactaaagag
gctggtccgggcagtttatactgctatcagatcaatggtgggatgcgggttcctgatccc
gcttctcgatttcagccccaagatatccacggtcccagcgaggtggttgatccagctact
tttaaatggcaggaagagggatggaatggacgaccttgggaagaggccgttatttatgaa
atccatgtaggaacttttaccccagagggtacttttcgaggattggagagtcacctggag
catctagcaaaattaggggtaaccgcattggaactgatgccggttgccgatttccctggc
cgttggaattggggttacgatggtgtttccttgtttgcaccagatagccgttatggtcgg
ccccacgatctcaaatcccttgtgcaagctgcccatgcttgtggattaatgatattttta
gacgtggtgtataatcatttcggtccggaaggcaactatctccatcaatatgccccagac
ttttttacagaacgccaccaaactccatggggggcagctatcaattttgatgggaagaat
gcccattgggtccggcagttttttatccataatgctctcttctggctggaggaataccaa
tttgatggccttcggttggatgcggttcatgcgattcaagatgattctaagttccatatt
cttgaagagttggcagagacgattttctgccatctagattccaggcggcgtatacatctg
gtgctagaaaatgataataatatagcccgttaccttacccggaagcctaacggacaaccc
cgttggtacactgcgcaatggaatgatgatatccaccatgccttgcatgtactcaccact
caggaaactacaggttattacttagactatgccgatcagcctattgctcatctaggccgt
tgtttgagcgaaggttttggttatcaagggcaacattctccttacagggaaggcaaaccc
cgtggcgagcctagcaagattttaccgccaagcgcttttgtaaccttctttcaaaaccac
gatcaagtgggtaacagggctttcggtgagcgaataacggctttaataacacctgaagaa
gtgaaggcattaaccgcgttgctattgctctctcctttcccgccccttttatttatgggc
caggagtggggatcaactcaaccctttccttttttttgcgattttagtgaggatttggct
gcaagtgttcgggagggtcggcgaagggaattcgcccattttcctgaattcaataatcca
gcggcccaagaacgaattccggatcctaccgctcaggcgacctttgacaatgctgtttta
aactggactcacgcaaccaatggaaaagggaaagaatggtttgagttacatcaaaatctg
ctaaaactacggcgccaatggatcattcccaggctagctgctatgagaaaaaacaacggt
tgttatatacccttaggtaagcaggcactacaagttcggtggcaattaggcgatggggca
caattaacaatattagctaacttaggaaaaatttctattttcttatcgactctcccttcc
ggagaagtactttttaccaccttttcagatttaaataggatacttatccacaaaaatctg
ccccctaagacggtaatttggtttctcaaagagaattccagtgattga

DBGET integrated database retrieval system