KEGG   Nitrosococcus oceani: Noc_1712Help
Entry
Noc_1712          CDS       T00281                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
noc  Nitrosococcus oceani
Pathway
noc00220  Arginine biosynthesis
noc00330  Arginine and proline metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01130  Biosynthesis of antibiotics
noc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Noc_1712
   00330 Arginine and proline metabolism
    Noc_1712
Enzymes [BR:noc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Noc_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABA58184
JGI: Noc1712
UniProt: Q3JAG2
Position
complement(1916393..1917322)
Genome map
AA seq 309 aa AA seqDB search
MKIIRIIGVASGWGALDRRCEAGPEALRRRGLVAHLRQQGMPVSWEITIQPQESQDDNAV
MAVQALSVELSQVAGNVVARGEPFIVLGGDHSCAIGTWSGAVSRRRIAGPVGLIWIDAHM
DAHLPETSPSGALHGMPLACLLGWGDPRLTAIGSPEPKFLPENVVLIGVRSFEPEEHRLL
QRLGVKVFFMDEVRRRGLSEVFYEALGRIRDRTTGFGISLDLDAIDPKEAPAVGSPVPGG
LAKEELLPLLRQLYGDPRLIGLEIAEYNPALDEKQLTARLISELLLSVFAPLRLPYESYH
RAGKAVLSA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcattcgtatcattggcgttgcaagtggttggggcgctttggatcgccgctgc
gaagcgggcccggaggccctccgccgccgaggtctagtggcccatctacgccaacaagga
atgcctgtttcctgggagatcacgatacaaccacaagagagtcaggatgataacgccgtg
atggcggtgcaggcactttccgtggaactgagccaggtggcaggtaatgtggttgctagg
ggtgagccctttattgttctaggaggcgatcattcttgcgctattgggacctggagcggg
gccgtttccaggcggcgaattgcaggacctgtgggacttatctggatagacgcccatatg
gacgctcatctgccagagaccagccccagtggcgccctgcacggcatgcctctggcctgc
cttctaggttggggagatcctcggctcaccgccattgggagtcctgagcctaagttcttg
ccagaaaatgtggtgcttattggggttcgtagctttgagccggaggagcatcgattgctt
cagcggttaggtgtgaaggttttttttatggacgaagtgcgccgccgcggattgagcgaa
gtgttttatgaggctttgggacgaatccgggaccggactacaggatttgggatcagtctt
gatctggatgctattgatcccaaagaggcccccgctgtgggttctccagtgccagggggc
ctcgccaaggaagaacttctaccgttgttgcgacagctctatggagatccccgtttgata
ggattagaaatcgccgaatataaccctgccctggatgaaaaacagctaacggctcgtctg
attagtgagctgctgctctcggtttttgcaccactgaggttaccctatgaatcctatcat
cgagctggaaaagcggtactcagcgcataa

DBGET integrated database retrieval system