KEGG   Nitrosococcus oceani: Noc_1712Help
Entry
Noc_1712          CDS       T00281                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
noc  Nitrosococcus oceani
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Noc_1712
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Noc_1712
Enzymes [BR:noc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Noc_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1916393..1917322)
Genome map
AA seq 309 aa AA seqDB search
MKIIRIIGVASGWGALDRRCEAGPEALRRRGLVAHLRQQGMPVSWEITIQPQESQDDNAV
MAVQALSVELSQVAGNVVARGEPFIVLGGDHSCAIGTWSGAVSRRRIAGPVGLIWIDAHM
DAHLPETSPSGALHGMPLACLLGWGDPRLTAIGSPEPKFLPENVVLIGVRSFEPEEHRLL
QRLGVKVFFMDEVRRRGLSEVFYEALGRIRDRTTGFGISLDLDAIDPKEAPAVGSPVPGG
LAKEELLPLLRQLYGDPRLIGLEIAEYNPALDEKQLTARLISELLLSVFAPLRLPYESYH
RAGKAVLSA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcattcgtatcattggcgttgcaagtggttggggcgctttggatcgccgctgc
gaagcgggcccggaggccctccgccgccgaggtctagtggcccatctacgccaacaagga
atgcctgtttcctgggagatcacgatacaaccacaagagagtcaggatgataacgccgtg
atggcggtgcaggcactttccgtggaactgagccaggtggcaggtaatgtggttgctagg
ggtgagccctttattgttctaggaggcgatcattcttgcgctattgggacctggagcggg
gccgtttccaggcggcgaattgcaggacctgtgggacttatctggatagacgcccatatg
gacgctcatctgccagagaccagccccagtggcgccctgcacggcatgcctctggcctgc
cttctaggttggggagatcctcggctcaccgccattgggagtcctgagcctaagttcttg
ccagaaaatgtggtgcttattggggttcgtagctttgagccggaggagcatcgattgctt
cagcggttaggtgtgaaggttttttttatggacgaagtgcgccgccgcggattgagcgaa
gtgttttatgaggctttgggacgaatccgggaccggactacaggatttgggatcagtctt
gatctggatgctattgatcccaaagaggcccccgctgtgggttctccagtgccagggggc
ctcgccaaggaagaacttctaccgttgttgcgacagctctatggagatccccgtttgata
ggattagaaatcgccgaatataaccctgccctggatgaaaaacagctaacggctcgtctg
attagtgagctgctgctctcggtttttgcaccactgaggttaccctatgaatcctatcat
cgagctggaaaagcggtactcagcgcataa

DBGET integrated database retrieval system