KEGG   Nitrosococcus oceani: Noc_1733Help
Entry
Noc_1733          CDS       T00281                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
noc  Nitrosococcus oceani
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_1733 (fadJ)
   01212 Fatty acid metabolism
    Noc_1733 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Noc_1733 (fadJ)
   00650 Butanoate metabolism
    Noc_1733 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Noc_1733 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Noc_1733 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Noc_1733 (fadJ)
   00310 Lysine degradation
    Noc_1733 (fadJ)
   00380 Tryptophan metabolism
    Noc_1733 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Noc_1733 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Noc_1733 (fadJ)
   00281 Geraniol degradation
    Noc_1733 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Noc_1733 (fadJ)
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Noc_1733 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Noc_1733 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Noc_1733 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1940508..1942742)
Genome map
AA seq 744 aa AA seqDB search
MTNGTFRSLRIEKREDNAAIIWLDVPDVSVNTLQADFAQDFNRVLEQLSADKDLEVVVLA
SAKEDFIAGADIKMLTQLPDAEAARQLSRTAQQAMDQLEAFPLPIVAAIHGVCLGGGLEV
ALACRGRVATNSARTRLGQPEVKLGVIPGVGGTQRLPRLVGLETALNMILTGKTHPASKA
CALGLVDEVVPRPVLLEAALARARELVQENNKEPEAGTFQQVSRIFGSMLSLRKVRSLLL
EKNSLGRSMVFNQAKKKVLSHTHGNLPAPLQALEVIKTGMEQGLEAGFKAEVEAFGDLAV
STKARNLMALFLAKSALKKDPGTDEEIAPRLVRKVGVLGAGLMGSGIAYVTAAKARLPVR
LKDLKQEVLRQGLRTLWNAVTEQVKKRRMTAGEGDRVLALVRPTTEYTGFKQADVVIEAV
VEDLKVKQQVLREVEAHGGPEMIFASNTSSIPIHKIAEASDRPEAVVGMHYFSPVPKVPL
LEVIVTEKTVPEVVATCVALGKQQNKTVIVVRDGAGFYTTRILAPYINEATHLLAEGVSI
QDIDKALVNFGFPVGPLKLLDEVGIDVVQKIAHILEEAFGERMKPTSVLAKLVSSHRLGK
KNGQGLYRYQKMDGIFKGKGKQVDQSVYQSLGIKPDKKLEANEIAMRCLLPMINEAVHCY
HEGILRSARDGDVGAVFGLGFPPFLGGPFRFIDNQGLRNVSKQLVHYQEQFGKRFTPASL
LVDLAQQGIGFYDENVPPPGKTLS
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatggaacgttccgctcactgcggattgaaaagcgggaagataacgcagctatt
atttggcttgatgtgcctgatgtttcggtcaatacattgcaggcggactttgctcaagat
tttaaccgagtgcttgaacaattgtcggcggataaggatttagaggtagtggtgctggcc
tcggccaaggaggattttatcgcgggcgccgatatcaagatgttgacccaattgccggat
gctgaggcggcccggcagctctcccgcaccgcccaacaagcgatggatcagctggaagct
tttcctctccccattgtagcggcgatccacggggtctgcctgggcggggggctggaggtg
gccttggcttgccgggggcgtgtggccaccaatagcgcccgcacccggttgggccagcca
gaagtcaaattgggggttattcctggcgtagggggcacccagcggttacctcgtctggta
ggtttggagacggctctgaatatgatattaacgggtaaaacccatcctgcttctaaagcc
tgcgctctgggattggttgacgaggtggtgcctcggccagtgctgttggaagcggctttg
gcccgtgcccgtgaacttgttcaggaaaataacaaggagcctgaagcgggcacatttcaa
caggttagccgaattttcggcagcatgttgagcttgcggaaggttagatcgctgttgttg
gaaaaaaattccctcgggcgctccatggtgtttaatcaggctaagaaaaaggtgctttcc
catacccatggcaatctaccggcgcccctccaggcgcttgaagtcatcaagacgggtatg
gagcagggcttggaagcgggctttaaagcggaagtggaggcttttggcgacttggctgtg
agcaccaaggcccgtaatctcatggcgttgtttttggcgaaatcagcgctgaaaaaagat
ccgggcaccgatgaagagatagcaccccggttagtgcgtaaagtgggcgttttgggagcg
ggcttgatgggaagtggcatagcctatgtaaccgctgcgaaagcgcgtttgccggtgcgc
ttaaaagaccttaagcaggaggtcttacggcaagggctccgcactttatggaatgccgtc
actgagcaagttaaaaaacggcgcatgacggcgggagaaggcgatcgggtacttgctttg
gtccgtcccaccaccgaatacaccggctttaaacaagccgatgtggtaattgaggcggtg
gtggaagatcttaaggtaaaacagcaggtgttgcgtgaagtagaagcccatggcggtccg
gagatgatttttgcttccaatacttcctctatccccattcataaaattgccgaggcgagt
gatcgtcccgaggcggtggttggcatgcattatttctcgcccgtgcccaaggtgccgctc
cttgaagttattgtaactgagaaaaccgtgccggaggtagtcgccacctgtgttgcactg
ggtaaacagcaaaacaaaacagtaatcgtggttcgtgatggggcgggtttttataccacg
cggatactggccccttatatcaatgaggccacgcatcttttagccgagggagtctccatt
caggatatcgataaggcattggttaattttggctttcccgtaggacctctcaaacttttg
gatgaggtgggtatcgatgtggtgcaaaagatcgcccatatcctggaggaagcctttggt
gagcggatgaaacctacatcagtgctcgcaaaattagtgagttcccatcgcttgggcaaa
aaaaatggccagggtttatatcgttatcagaaaatggatgggatttttaaaggaaaagga
aagcaggtagatcaatccgtttatcagtcattaggtatcaaaccagataaaaagttagag
gccaatgaaattgcgatgcgttgccttctaccgatgattaatgaggcggtgcattgctac
cacgagggtattttacggtcagcccgggacggcgatgtaggcgctgtttttgggttaggt
tttccaccttttttagggggtccttttcgctttattgataaccagggattgaggaatgtt
tccaagcaactcgtccattaccaagagcagtttggtaaacgttttacgcctgcttctctc
ctagttgatctagcccaacaaggaatcggtttttatgatgaaaatgtgcctccgccaggg
aaaaccctttcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system