KEGG   Nitrosococcus oceani: Noc_1826Help
Entry
Noc_1826          CDS       T00281                                 

Definition
glycogen debranching protein (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
noc  Nitrosococcus oceani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Noc_1826
Enzymes [BR:noc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Noc_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2071070..2073088)
Genome map
AA seq 672 aa AA seqDB search
MTLTLPPPIRFGREICGDLAQGERREWWLTNSLGGYAAGTVAGTLTRRYHGLLIAPLTPP
LGRFLVFAKAEASLLYQDQVIPLFTNRWASGAVDPRGYVHLESFELQGRMPVWRFAVGDL
ALEARLWLEPDAHTTYLAYRLVNPSSSSSSGGSVRLRLKLLVNARDHHGTASPGALSPVM
EGEADRLRVIHPHWFSLYFRAQGGSITRESSWIEDFDLSLERERGLPDRDRHLCVGQAEL
SLSWKGWVGMVASLQPETSSLEEAMERFQAHELKVLRRASTGVKEEFKAPSWIRRLVLAA
DSFLFARPLPNHPKGESVIAGYPWFGDWGRDTMIALPGLTLVTGRFESARRILETFAEFI
DQGLLPNWFPGKGETPEYNSADGALWFIEAWRAYVAATDDRMALKRWFGVLEEIVRKYQQ
GTRHGIGMDLADGLIAIRAPGLQLTWMDAKVGEWVVTPRQGKPVEINALWFNALWALASL
AEALGQSDLPYRDLARKTQRGFQRFIRPEGEGLFDVIDGPEGADRAVRPNQILAVSLPHS
PLDATAQAGIVRQCGRELLCSYGLRSLSPAHPAYQPHYQGDVWARDGAYHQGTVWAWLLG
HYALAHYRVHGDGAAAQNLLAPVGDHLLDAGLGTVSEIFDGAPPHRPRGAPAQAWSVACV
LQAWWQLEQTKD
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgactcttccccctcctatccgctttggccgggaaatctgcggcgaccttgca
cagggagaacggcgtgagtggtggctgaccaatagccttggcggttacgctgccggcacg
gtggcgggaaccctgacgcggcgctaccatggtttgctgattgcccccctaacaccaccc
ctaggacgttttctggttttcgccaaggctgaggcaagtttactttaccaggaccaggta
atccccctatttactaaccgctgggcaagtggcgcagtcgatccaaggggttatgtccat
ttggaatcctttgagcttcaaggccggatgccagtttggcgttttgccgtgggtgatcta
gccctggaagcgcgcctctggctggaaccagatgcccacactacttacttggcctatcgg
ttggtaaatccatcgtcttcctcttcctctgggggctcggttcgccttcgcctcaagctg
ctggtgaatgcccgggatcaccacggtaccgcctcgcctggagcgttgagcccagtgatg
gaaggggaggcggatcggctgcgggtgattcacccccactggttcagtttgtattttcgt
gctcaaggaggttccataaccagagagtcctcctggattgaagattttgatctttccctg
gaacgggagcggggcctgccggatcgtgatcgccatctttgtgtggggcaagctgaactg
agtctgtcttggaaaggttgggtaggcatggtagccagtctccagccagagacttcttcc
ctggaagaagccatggagcgttttcaggctcatgaattaaaggtgttaaggcgggctagc
accggcgttaaagaggaatttaaagcgccctcctggattcggcggttagtgctagcggcg
gatagctttctttttgcccgccctctccctaaccacccgaagggggaatcggtcatcgcc
ggttatccctggtttggggattggggccgggataccatgatcgccttgccgggactgacc
ctggtgacgggtcgctttgagagcgcccgccggattttggagacctttgccgagtttatc
gaccaaggactattgccgaattggtttccaggcaaaggcgagacgccggaatataatagc
gccgatggtgccctttggtttattgaagcctggcgggcttatgtggcggccacggatgac
cgaatggcgctcaagcgctggtttggggtgctcgaagaaattgtgcggaaataccaacaa
gggactcgccatggcattggcatggacctggcggatgggttgattgctatcagggcacca
ggattgcagcttacctggatggatgccaaggtgggtgaatgggtggtcacgccccgccag
ggcaagccagtggagatcaatgccttgtggttcaatgccttgtgggccctggcctccttg
gcggaagcactgggccagtccgatttaccttaccgggacttggctaggaagacccagcgg
ggcttccaacgttttataaggccggaaggggagggtttattcgatgtcatcgatggacct
gaaggagcggatagggccgtccggcccaatcagattttggcggtgagtttgccccacagt
ccccttgatgccaccgcccaggctgggatagtgcgccagtgtggacgggagttgctgtgc
tcctatggactgcgttccctctctcccgcccacccggcttatcagccccactatcagggg
gatgtttgggcccgggatggggcttatcaccaggggacggtatgggcctggctgttgggc
cattacgccctggcccactatcgagtccatggggatggagcagcggcccagaatctgctt
gcgcctgtgggggatcaccttctggacgctggccttggcacggtgagcgaaattttcgat
ggagcgcctccccatcggccccggggggcgcccgctcaagcctggtcggtagcctgtgta
ctccaagcctggtggcagcttgaacagactaaagattaa

DBGET integrated database retrieval system