KEGG   Nitrosococcus oceani: Noc_1891Help
Entry
Noc_1891          CDS       T00281                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
noc  Nitrosococcus oceani
Pathway
noc00071  Fatty acid degradation
noc00072  Synthesis and degradation of ketone bodies
noc00280  Valine, leucine and isoleucine degradation
noc00310  Lysine degradation
noc00362  Benzoate degradation
noc00380  Tryptophan metabolism
noc00620  Pyruvate metabolism
noc00630  Glyoxylate and dicarboxylate metabolism
noc00640  Propanoate metabolism
noc00650  Butanoate metabolism
noc00900  Terpenoid backbone biosynthesis
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
noc01212  Fatty acid metabolism
noc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Noc_1891
   00630 Glyoxylate and dicarboxylate metabolism
    Noc_1891
   00640 Propanoate metabolism
    Noc_1891
   00650 Butanoate metabolism
    Noc_1891
  Lipid metabolism
   00071 Fatty acid degradation
    Noc_1891
   00072 Synthesis and degradation of ketone bodies
    Noc_1891
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Noc_1891
   00310 Lysine degradation
    Noc_1891
   00380 Tryptophan metabolism
    Noc_1891
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Noc_1891
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Noc_1891
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Noc_1891
Enzymes [BR:noc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Noc_1891
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Noc_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ABA58357
JGI: Noc1891
UniProt: Q3J9Y9
Position
complement(2155731..2156906)
Genome map
AA seq 391 aa AA seqDB search
MNPDDIVIVAARRTPVGSFLGQLSPLSAPALGSAVLQAVLADSGAEAARISEVVMGCVLP
AGTGQAPARQAALGAGVPATVGCTTINKVCGSGMKAIMLGHDLCLAGSAEMVLAGGMESM
SNAPYLLPKARQGFRFGHQQVLDHMLLDGLENARDGQPMGYFAELCADRYGFSREQQDAF
AAESVRRAVAALDNGALVAEIVPLSVPGRREARRVHEDEQPRRSDIAKIPTLKPVFREGG
TVTAANASSLSDGAAAVLLLKRSTAAALGLSPLARIVAHGSHAQAPEEFTTAPIGAIKKL
QDKLDWPEADLYEINEAFAVVALAAMKELGLDHAKVNVKGGACAVGHPIGASGARLVVTL
LHALRQRGLQRGIAALCIGGGEATAMALEIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagatgatattgtcattgttgcggccagaagaaccccggtaggtagttttctc
ggtcaactttctcccttatcggcaccagcattaggctcggcggtattacaggcggttctg
gccgacagtggcgcggaggcggcgcgtattagcgaagtagtgatggggtgcgtgctgcca
gcgggcactgggcaggcgccggcccggcaggcggcgcttggggcgggagttccggcaacg
gtaggttgcactacaatcaataaggtctgcggttcgggaatgaaagctatcatgctgggg
catgatctctgcctggcaggctccgctgagatggtactggctggtgggatggagtccatg
agcaatgcgccttatctgctgcccaaagcccgccaggggttccgctttgggcaccaacag
gtgcttgaccacatgcttttagatggactggaaaacgcccgggatggccagcccatgggc
tattttgcggaactttgcgcggatcgctacggctttagccgggaacagcaggatgccttt
gccgcggaatcggttcgccgcgccgtggctgccctggataacggtgccttggtggctgaa
atcgtgccgctaagcgtgcctgggcggcgggaagcgcggcgggtccatgaagatgaacaa
ccccgccggagtgacattgccaagattcccaccttaaagccggtttttcgcgaggggggg
acggtcaccgcggccaatgcctcctccctttccgatggggctgccgccgtgttgctactg
aaacgctcgactgcggctgccctgggcctgtctcccctggcgcggattgtggcccatggg
agccatgcccaagcaccggaggagtttactacagcccctattggggcgatcaaaaaactc
caggataaacttgactggccggaggcggatctctatgaaatcaacgaggctttcgccgtg
gtggccttggccgccatgaaggaattgggtctggaccatgccaaggtgaatgtgaagggt
ggcgcctgtgcggtgggtcatcccattggcgctagcggtgcccggttggtggtaaccttg
ctccatgccctacgccagcggggcctccagcgggggatcgccgccctctgtatcggtggg
ggtgaagccactgccatggccctagaaatcgagtga

DBGET integrated database retrieval system