KEGG   Nitrosococcus oceani: Noc_1975Help
Entry
Noc_1975          CDS       T00281                                 

Definition
(GenBank) Asparagine synthase, glutamine-hydrolyzing
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
noc  Nitrosococcus oceani
Pathway
noc00250  Alanine, aspartate and glutamate metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Noc_1975
Enzymes [BR:noc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Noc_1975
Peptidases [BR:noc01002]
 Cysteine Peptidases
  Family C44
   Noc_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC Glyco_tran_WbsX NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ABA58437
JGI: Noc1975
UniProt: Q3J9Q9
Position
complement(2267359..2269290)
Genome map
AA seq 643 aa AA seqDB search
MCGITGIFDLHERRPIDREILSRMNDIQRHRGPDGGGIHVEPGIGLAHRRLSIIDLSLGR
QPLSNEDGTVWVTYNGEIYNFKELMAELSHRGHVFRTQCDTEVIVHAWEEWGEKCVHHFR
GMFAFAIWDRKQETLFLARDRLGIKPLYYALLPNGQLIFGSELKALITHPHLPRQLDSLA
VEDYFAFGYIPDPRTIFRYANKLAPGHTLTLRCGASKLEPRQYWDVTLEPQALGSESAIE
ETLIEKFREAVNIRLVADVPLGAFLSGGVDSSAVVAAMAQLSNDPVRTCSIGFSDPAFDE
ARYAEQVAHRYGTNHHSAQVDQDDFELINRLAGVYDEPYADSSAMPTYRVCELARQRVKV
VLSGDGGDELFAGYRRYRWHLHEQRVRGILPLSMRQPLFGILGHYYPKLDWAPRIFRAKT
TFQALARDPLEGYFHSVAVIPNELRHRLFSQRMRQELQGYEASQVLRNHARQAPDHPLLQ
VQYLDLKTYLPGDILTKVDRASMAHGLEVRVPLLDHPFVEWAGGLSPHFKYRSREGKYVF
KRALRPYLSDEILYRRKMGFAVPLAAWFRGPLRERVRTAVTGQILAETGLFEMPILRHLV
DQHLSGLRDYSASIWSLLMFDAFLRQAMEGESYDRNASSSISA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggtataacaggtatttttgacctccatgagcgccgccccatcgaccgggaaatt
ctctcgcgtatgaatgatattcagcgccaccggggtccggatggtggtggcatccatgtg
gaacctggcatcggtcttgctcatcgccgtctttctatcatcgatttgtccttaggccgt
cagcccctcagtaacgaagatggtacggtttgggtgacctataacggcgagatttacaat
tttaaggaacttatggctgagcttagccaccgcggccatgtttttcgcacccagtgcgat
acggaggtcatcgtccatgcttgggaggaatggggtgagaagtgcgtgcatcattttcgg
ggtatgtttgcttttgctatttgggatcgcaagcaggaaacgctttttctggcccgcgat
agattaggcattaagccgctgtattatgcattgctgcccaatgggcagctcatttttggt
tctgaactcaaggcgcttattacccatcctcatttgccgcgccagctcgattctttggcg
gtagaagattattttgctttcggttatattcccgatcctcgcactattttccgttatgct
aataagcttgcgccgggccacacacttacgctccgttgtggggcgtcaaaattggagcca
cggcagtactgggatgttactttagagccacaagcgttaggttctgagtcagccatagaa
gaaacccttattgaaaaattccgagaagcggtcaatattagattggttgcggatgtccct
cttggggcattcctttccggtggtgtagactccagcgccgtggtggcggccatggcccaa
ttgtctaatgatccagtacgtacctgctcgattggtttttctgatccagcatttgatgaa
gcccgctacgccgagcaggtcgcccatcgttatggcactaatcatcattctgctcaagtc
gatcaggatgatttcgagctaattaaccggctggcaggggtttatgacgagccctacgct
gactcgtccgctatgcctacctatagagtgtgcgaactggcgcgccagcgggtaaaggtt
gttctctctggtgatggaggcgatgaactctttgcgggttaccgtcgttaccgttggcac
ttgcatgagcagcgggtgcggggaatcttgccactgagcatgcggcagcctctgtttggt
atcttggggcattactatcctaaacttgattgggcgccgcgcatctttcgcgctaagaca
accttccaagcattggctcgcgatcccctggaaggctactttcacagtgtggcggtgatt
ccgaatgaattacgccatcgccttttcagccaaaggatgcgccaagagcttcagggttat
gaggcatcgcaggtattgcgaaaccatgcccgacaggcacccgatcatccactgcttcag
gtccagtacttagacctaaaaacctatttacccggcgacattcttactaaagtagatcgc
gctagcatggcccatggccttgaagtgcgggtaccgttgctggaccatccgtttgtcgag
tgggctggcggcttatctccccattttaagtaccgaagtagggagggaaagtacgtattt
aagcgggctctgcgcccctacctttcagatgagattttatatcggcggaaaatgggtttt
gcggtaccgttagccgcctggtttcgaggcccgctccgggaacgagtccgcactgcagtg
accggacaaatactagcagaaactgggcttttcgagatgccaatcttgcggcatctggtc
gaccagcacctatcaggactacgtgattacagtgcgtccatttggtccctcttgatgttt
gatgccttcttgcgtcaggctatggagggagaatcctatgaccggaatgcttctagcagc
atctcggcttga

DBGET integrated database retrieval system