KEGG   Nitrosococcus oceani: Noc_2183Help
Entry
Noc_2183          CDS       T00281                                 

Definition
(GenBank) Glycoside hydrolase, family 3-like protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
noc  Nitrosococcus oceani
Pathway
noc00520  Amino sugar and nucleotide sugar metabolism
noc01100  Metabolic pathways
noc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Noc_2183
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Noc_2183
Enzymes [BR:noc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Noc_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABA58643
JGI: Noc2183
UniProt: Q3J953
Position
complement(2523258..2524283)
Genome map
AA seq 341 aa AA seqDB search
MTLGPLMIDLKGVTLDSEERAWLGHSWVGGVILFSRNYESPEQIAALIKAVHALKEPRLL
VAVDHEGGRVQRFRDGFTLLPPASLLGKLYDRDQRQAQRLAMITGWLMAVELRAVGVDFS
FSPVLDLDRGVSAVIGDRAFHGEPDAVIALARAYIRGMAWAGMAAVGKHFPGHGSVVADS
HTALPVDKRSWRQIREGDLLPFEHLARAGLPAVMPAHVRYASVDSRPVGFSPFWLETVLR
GQLGFQGAIISDDLSMAGAAEVGDMSARMQAALSAGCDMALVCNDPDGYALLLDELKGDP
YPQTSPRLLRLYGRYPLTRSQLYHNPAWQRAVQMLAAYGEF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactctaggccctttgatgattgacttaaaaggtgtaacgctggactcggaggaacgg
gcgtggttaggccattcctgggtaggcggagtcattttatttagccgtaactatgaatct
ccggaacaaattgcagcgttgatcaaggcagttcacgcgctcaaggaacctcggttattg
gtggccgtggatcatgagggaggacgtgtacagcgtttccgggatggctttaccctttta
ccgccggcctctctcctgggtaagctttatgatcgggatcagcgccaagctcagcgttta
gcgatgataactggttggctgatggcggttgaattgcgggcggttggcgttgatttcagt
ttttcccctgtcttggatttggatcggggagtcagcgcggtgataggagatcgggccttt
cacggggagcctgacgccgtgatagccttagctagagcttatatccgggggatggcctgg
gcgggcatggctgcggtgggtaaacactttccgggtcatggatcagtggtggccgactcc
cataccgcccttccagtagataaacgttcctggcggcagatccgggagggggatcttctg
ccttttgagcatttagcgagagccggcctgccagcggtcatgcccgcccatgtgcgctat
gcttcagtggattcccgccccgtcggtttttcccctttctggctggagaccgtcttgcgc
gggcaattgggctttcaaggcgccattattagcgatgatttgagtatggccggcgcggcg
gaagtaggggatatgagcgcacggatgcaagcggctttaagcgccggctgtgatatggcc
ttagtctgtaatgatcctgacggttatgctctcttattggatgagttgaagggggaccct
taccctcagacttccccccgtctgctgcgactctatggccgctatcccctgacccgctcc
cagctataccataatcccgcttggcaaagagcggtgcagatgctcgctgcctatggcgag
ttttag

DBGET integrated database retrieval system