KEGG   Nitrosococcus oceani: Noc_2280Help
Entry
Noc_2280          CDS       T00281                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
noc  Nitrosococcus oceani
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Noc_2280
   00052 Galactose metabolism
    Noc_2280
   00500 Starch and sucrose metabolism
    Noc_2280
   00520 Amino sugar and nucleotide sugar metabolism
    Noc_2280
Enzymes [BR:noc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Noc_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2630379..2631272)
Genome map
AA seq 297 aa AA seqDB search
MTKPITKAVFPVAGLGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGIKVMVFVTGR
NKRPIPDHFDMAYELEAELERRGKNKLLKLVQDIIPRDVTCVYIRQEETLGLGHAVLCAA
PVVGEEPFAVILADDLIDAGMEGCLSQMVKQFSKHHCSLVGVEEVASDSTDQYGIIQPGL
AEDREYKVEGIVEKPEPAEAPSSLAVVGRYILTPRIFSLLEATPHGVGGEIQLTDALATL
LSEEYMFAYRFEGKRYDCGSKLGYLQATVEYGLKHTELGDPFRDYLCGLVAQIEAPL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacccattactaaagctgtattccctgtggcgggattaggaacccgtttcctt
cccgcgaccaaagcaaacccaaaagagatgctgccaatcgtcgataagcctctcattcaa
tatgcggttgaagaagcggttgaggcagggatcaaggttatggtttttgttactgggcgg
aataagcgtccgattcctgatcatttcgatatggcttatgaacttgaagcagaactggaa
agacgcggtaaaaacaagctactcaagttggtacaggacattattcctagggatgtgacc
tgcgtttatatccgtcaggaggaaactttagggttagggcatgcggtgctttgtgccgcg
ccagttgtgggcgaagagccctttgcagtgatccttgctgatgatctgattgatgcgggg
atggagggatgtctctcccaaatggtgaagcaatttagtaagcatcattgcagcctagtg
ggcgtggaggaggtcgcttctgacagcaccgatcaatacggtattattcagcctggcttg
gcagaggaccgggagtacaaagtggaaggaattgtcgagaagcctgaaccggcagaggcc
ccctcatccttggcggtggtagggcgttatattttaaccccccgtattttcagtctatta
gaagctacccctcacggagttgggggagaaattcaattaactgatgcccttgctacttta
ttaagcgaggagtatatgtttgcttatcgctttgaaggcaagcgctatgattgtggcagt
aaattaggctaccttcaagccacagtggagtacggccttaagcataccgagttaggcgat
cctttcagagactatttatgcggcttggttgctcaaattgaggccccgctttga

DBGET integrated database retrieval system