KEGG   Nitrosococcus oceani: Noc_2453Help
Entry
Noc_2453          CDS       T00281                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
noc  Nitrosococcus oceani
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Noc_2453
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noc_2453
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Noc_2453
Enzymes [BR:noc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Noc_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2798828..2799910)
Genome map
AA seq 360 aa AA seqDB search
MPFRSRYTGLIDKYRDRLSVHDDTRVISLGEGNTPLIRLNNIPRVLGREVDIYIKYEGLN
PTSSFKDRGMTMAVTKAVEEGSRAIICASTGNTSASAAAYAARAGITAFVLIPEGKIAHG
KLAQAMMHGAIVIQIKGNFDKGMQLVKEVANKAPVTIVNSINPYRIQGQKTAAFEIIEEL
ECAPDFHCLPVGNAGNITAHWMGYSEYHAHGIVNTRPRMCGYQASGAAPFLEGKMVDQPE
TVATAIRIGHPQSWDKAWKAQEESQGWFSACTDEEILAAQKLLAEREGVFCEPASAAGLA
GAIRDIEAGKIPSDSKIVCTLTGHGLKDPDTAIAQSKAPLVAVEASLESVQGAILDNLES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgatctcgttatactggccttatcgataaataccgggaccgcttatcggtc
catgacgacactcgggtaataagcctgggagagggaaatactccccttattaggctgaat
aatattccgcgagtgttgggccgggaggttgatatctatattaagtatgaaggactaaac
ccgacaagttcttttaaagaccgtggtatgactatggctgttacgaaggccgtcgaggag
ggtagccgggctattatctgcgcctccaccggtaatacttcggcctcggcggctgcctat
gcggcacgggcgggaattactgcattcgtgcttatcccggaaggtaaaatcgcccatggc
aagcttgctcaggctatgatgcacggagcaatcgtcatccaaatcaagggtaacttcgat
aaaggcatgcaattagtcaaggaagtggcgaataaagcgcccgtgaccattgtgaactct
attaatccttaccgtatccagggacaaaaaacggcggccttcgagatcatcgaagagctg
gaatgtgccccggatttccattgcttaccggtgggcaacgcaggcaatatcactgcccat
tggatgggctacagtgaatatcatgcccatgggatcgtcaatacacggccccgcatgtgc
ggttatcaagccagcggggcagctccctttcttgagggtaaaatggtggaccaaccggaa
acggttgctaccgctattcgtattggccatccccaaagttgggacaaggcatggaaagca
caggaggaatcccagggctggtttagcgcctgcaccgacgaagaaatcctggcggctcaa
aaattacttgcggaaagagaaggtgtattttgcgagcccgcttcggccgctgggttagct
ggagcgatacgggatatcgaagcgggtaaaatacccagtgatagtaaaatcgtttgcacc
ctcactggccacggtttaaaggatccggataccgccatcgcccagagcaaagcgcccctg
gtagcggttgaagcgagcctagagtcggttcagggggctattttagataatttggaaagc
tag

DBGET integrated database retrieval system