KEGG   Nitrosococcus oceani: Noc_2472Help
Entry
Noc_2472          CDS       T00281                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
noc  Nitrosococcus oceani
Pathway
noc00020  Citrate cycle (TCA cycle)
noc00190  Oxidative phosphorylation
noc00650  Butanoate metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
Module
noc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
noc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noc_2472
   00650 Butanoate metabolism
    Noc_2472
  Energy metabolism
   00190 Oxidative phosphorylation
    Noc_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C Serpentine_r_xa
Motif
Other DBs
NCBI-ProteinID: ABA58925
JGI: Noc2472
UniProt: Q3J8C1
Position
complement(2817652..2817969)
Genome map
AA seq 105 aa AA seqDB search
MTGLRAWLVQRGTAVIMLVLLLFFLARLMQGSFKTYEAWREWISDPLVSIMVALFFGVLL
LHSWVGLRDIILDYVRPVSLRLFAHSLIVVVYSGIGFWVIRILLR
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgactggcctgcgcgcttggctggtacagcgtggaacagccgtaatcatgttagtgctg
ttgttgttttttcttgcccgcctaatgcaaggctcctttaagacctatgaagcttggcgg
gaatggatcagcgatccgctggtaagcattatggtagccctcttttttggcgtcctgctg
ctgcactcttgggtgggtttgcgagacattattttagactatgtacgtcctgtatcgctg
cgcttgtttgcccattccttgattgtggtagtgtatagcgggataggtttttgggttatt
aggatattgttaagatga

DBGET integrated database retrieval system