KEGG   Nitrosococcus oceani: Noc_2472Help
Entry
Noc_2472          CDS       T00281                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
noc  Nitrosococcus oceani
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_2472
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noc_2472
   00650 Butanoate metabolism
    Noc_2472
  Energy metabolism
   00190 Oxidative phosphorylation
    Noc_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2817652..2817969)
Genome map
AA seq 105 aa AA seqDB search
MTGLRAWLVQRGTAVIMLVLLLFFLARLMQGSFKTYEAWREWISDPLVSIMVALFFGVLL
LHSWVGLRDIILDYVRPVSLRLFAHSLIVVVYSGIGFWVIRILLR
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgactggcctgcgcgcttggctggtacagcgtggaacagccgtaatcatgttagtgctg
ttgttgttttttcttgcccgcctaatgcaaggctcctttaagacctatgaagcttggcgg
gaatggatcagcgatccgctggtaagcattatggtagccctcttttttggcgtcctgctg
ctgcactcttgggtgggtttgcgagacattattttagactatgtacgtcctgtatcgctg
cgcttgtttgcccattccttgattgtggtagtgtatagcgggataggtttttgggttatt
aggatattgttaagatga

DBGET integrated database retrieval system