KEGG   Nitrosococcus oceani: Noc_2566Help
Entry
Noc_2566          CDS       T00281                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
noc  Nitrosococcus oceani
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_2566
   01230 Biosynthesis of amino acids
    Noc_2566
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_2566
   00051 Fructose and mannose metabolism
    Noc_2566
   00562 Inositol phosphate metabolism
    Noc_2566
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Noc_2566
Enzymes [BR:noc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Noc_2566
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Noc_2566
  Exosomal proteins of bladder cancer cells
   Noc_2566
  Exosomal proteins of melanoma cells
   Noc_2566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2917384..2918136)
Genome map
AA seq 250 aa AA seqDB search
MRTPLVVGNWKMNGSRAANRALLESMRKEMEAGVTAEVAVCPPFVYLADMESLLQGSVIN
WGAQNLSHHEVGAYTGEIAPSMLADLGCRFVIVGHSERRTLYGETDSLVAEKAIVAQKVN
IIPIICVGETLQEREQNITEQVVKRQLNAVLELAGVNALEKAVIAYEPIWAIGTGRTATP
EQAQEVHALIRSHVAIQNSGIAEELLILYGGSVKGNNAAELLAMPDIDGGLIGGASLDAK
EFLTICQAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacacccctagttgttggtaactggaagatgaatggttcgcgggccgccaaccgc
gctttgttagaatccatgcgcaaagaaatggaggctggagtaactgcggaggtggcggtt
tgcccgccttttgtatatcttgctgacatggaatctttgttacagggatcggttattaat
tggggcgctcaaaatttatctcaccatgaagtgggagcgtatactggagaaatcgcccct
tccatgctagctgatctaggctgccgttttgtcattgtaggccactccgaacggcgtacc
ctctatggagaaacggatagtctcgtggctgaaaaggctattgttgcccagaaggtaaat
attattcctatcatttgtgttggtgaaactctgcaagagcgcgagcaaaatattactgaa
caagttgtaaagcgccagctaaatgccgttttagagcttgctggcgttaacgccttagag
aaagctgttattgcctatgaaccgatatgggccattggtactggccgtactgcgactccc
gaacaagcccaggaggtgcatgctctcatacgaagtcatgtggcaattcagaattccggt
atagcagaggaattgctcattctctatggtggcagcgtcaagggaaacaatgcggcggaa
ttattagcgatgccggatatcgatggtggtttaattggcggggcctccctggatgccaaa
gaattcttgacaatctgccaagcggcgggctaa

DBGET integrated database retrieval system