KEGG   Nitrosococcus oceani: Noc_2568Help
Entry
Noc_2568          CDS       T00281                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
noc  Nitrosococcus oceani
Pathway
noc00790  Folate biosynthesis
noc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Noc_2568
Enzymes [BR:noc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Noc_2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABA59021
JGI: Noc2568
UniProt: Q3J825
Position
complement(2919605..2920465)
Genome map
AA seq 286 aa AA seqDB search
MAHCASPLSRYLDCGGKVLNLNRPQVMGVLNITPDSFSDGGKYLILEQALQRAHQMIQEG
AAIIDVGGESTRPGAAPVSVEEELHRVIPVIKALSREISIPLSIDTSKPEIMRAAVAAGA
GFINDINALRQEGALAAARELGVPICLMHMRGKPQTMQQNPAYDDVVEEVRGFLLDRIIA
CERGGIPRERLLVDPGFGFGKKSVHNLLLLKYLHRICELGLPVLVGLSRKSLIGTMLQLP
VGERLYGSLALATLAAWQGATMVRTHDVQATMQVLALCDSAQKAEE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcgcattgcgcatctcccctgtcacgatatcttgactgtgggggtaaggttctcaac
cttaatcgtccccaagttatgggggttctcaacatcacccctgactctttttccgacggc
ggtaaatatctgattttagagcaagcccttcagcgtgcgcaccagatgatacaagagggg
gcggctatcatcgatgtgggtggtgaatcaacccgccctggtgcggcccccgtctctgta
gaagaagaattgcaccgggttattcctgtcatcaaggctcttagccgagaaatttctatc
cctctttctattgatactagtaaacccgaaataatgcgtgctgcggttgcagcgggggcc
ggttttattaatgatattaacgcgcttcggcaggagggcgcgttagcagcggctcgtgag
ctgggagtacccatttgtttaatgcatatgcggggcaagccccagaccatgcagcaaaat
cctgcttatgatgatgtagtggaggaagtgcggggatttttgttagatcggataattgcc
tgtgaacggggtggcattcctagggaacggctacttgttgatcctggctttggttttggc
aagaaatctgtccataacctattgttacttaagtacctccaccgtatttgtgagcttggt
cttcccgtgttggtagggctttcgcgtaagtctcttattggtacaatgctacaattaccg
gtaggagagcgcctctatggtagtttagctctggctaccttagctgcttggcaaggcgct
accatggtgcggacccatgatgttcaagcgacgatgcaagtactagctctttgcgatagc
gcccaaaaggcagaagaataa

DBGET integrated database retrieval system