KEGG   Nitrosococcus oceani: Noc_2595Help
Entry
Noc_2595          CDS       T00281                                 

Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
noc  Nitrosococcus oceani
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:noc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Noc_2595
DNA repair and recombination proteins [BR:noc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Noc_2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2950227..2950826
Genome map
AA seq 199 aa AA seqDB search
MSLFGLSLGRLLEALRCLPGVGPKSAQRMAFHLLESDREGGRHLAQALLEALDKMTHCQT
CRILSETDLCSLCADSRRDRGQLCVVEMPSDVQAIEQATSYSGRYFVLMGHLSPLDGVGP
EALGMDLLAKRLDTDQIREVILATNLTVEGEATAYYISELAQTRGITTTRIAHGVPLGGE
LEFIDSNTLSHAFQSRRHL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttattcggcctttccctaggacgcctccttgaggccctgcgctgccttcccggc
gttggccctaaatccgcgcagcgcatggcctttcacctattggaatctgatcgggaaggg
ggacgacaccttgcccaagcattgttggaggcgctggacaagatgacgcactgccaaact
tgccgcatcctcagtgaaaccgatctatgctccctctgtgccgattccagacgggatcgc
gggcaactttgtgttgtggaaatgcccagcgatgttcaagctattgagcaagcaacaagc
tattctggtagatatttcgttctaatggggcacctatctccccttgatggcgtaggtccc
gaagcattgggtatggacttgctggcaaaacgattggatacagatcaaattcgcgaggtt
atccttgccactaatctaaccgttgagggcgaagcaaccgcctattacatcagtgaattg
gcgcaaactcgagggatcactaccacccgtattgcccatggagttcctctaggtggtgag
cttgaattcattgatagcaacaccctatcccacgccttccaaagtcgccggcatctttaa

DBGET integrated database retrieval system