KEGG   Nitrosococcus oceani: Noc_2595Help
Entry
Noc_2595          CDS       T00281                                 

Definition
RecR protein
Orthology
K06187  
recombination protein RecR
Organism
noc  Nitrosococcus oceani
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:noc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2950227..2950826
Genome map
AA seq 199 aa AA seqDB search
MSLFGLSLGRLLEALRCLPGVGPKSAQRMAFHLLESDREGGRHLAQALLEALDKMTHCQT
CRILSETDLCSLCADSRRDRGQLCVVEMPSDVQAIEQATSYSGRYFVLMGHLSPLDGVGP
EALGMDLLAKRLDTDQIREVILATNLTVEGEATAYYISELAQTRGITTTRIAHGVPLGGE
LEFIDSNTLSHAFQSRRHL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttattcggcctttccctaggacgcctccttgaggccctgcgctgccttcccggc
gttggccctaaatccgcgcagcgcatggcctttcacctattggaatctgatcgggaaggg
ggacgacaccttgcccaagcattgttggaggcgctggacaagatgacgcactgccaaact
tgccgcatcctcagtgaaaccgatctatgctccctctgtgccgattccagacgggatcgc
gggcaactttgtgttgtggaaatgcccagcgatgttcaagctattgagcaagcaacaagc
tattctggtagatatttcgttctaatggggcacctatctccccttgatggcgtaggtccc
gaagcattgggtatggacttgctggcaaaacgattggatacagatcaaattcgcgaggtt
atccttgccactaatctaaccgttgagggcgaagcaaccgcctattacatcagtgaattg
gcgcaaactcgagggatcactaccacccgtattgcccatggagttcctctaggtggtgag
cttgaattcattgatagcaacaccctatcccacgccttccaaagtcgccggcatctttaa

DBGET integrated database retrieval system