KEGG   Nitrosococcus oceani: Noc_2617Help
Entry
Noc_2617          CDS       T00281                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
noc  Nitrosococcus oceani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2973277..2973915)
Genome map
AA seq 212 aa AA seqDB search
MNLEQARVNMVEQQIRPWEVLDQRVLDRLAAVLREDFVPPAFRKLAYADVQIPLGQGQVM
LPPIIEGRLLQALDLKESESVLEIGTGTGYLTTVMAGLAGHVISVDIFPELRRFPEQLLA
NISLEVGDAARGWSKGGPFDAIAITGALPDLPRAFLETLKPGGRLFAILGRAPAMEAVLI
TRVGEQEWSREGLFETVIPLLLNSESKPKFVF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggagcaagctcgcgttaatatggtggaacagcagatccgcccatgggaagta
ctcgatcagcgggtattggatcggcttgccgccgtacttcgggaagattttgttccgcca
gcatttaggaagttggcttacgcggatgttcaaataccccttgggcaaggacaagtgatg
ttaccacccatcatcgagggccgtttactccaagctttggatctgaaggagtcagaatcc
gttttggagataggaaccgggactggttatctaacaacagttatggccggtttggctggc
catgtaattagtgtcgatatttttcctgaattacggcgctttcctgaacagctgctggca
aatatttctctggaggtaggggatgcggcccgtggctggtctaagggggggcctttcgat
gccattgcgatcacgggcgctcttcctgatttgcctcgtgcttttctggaaacactcaaa
ccgggtggacgtttgtttgcaattctaggccgggcgccggcgatggaagcagtactcatt
acccgcgtaggtgagcaagagtggtcccgggaggggttgtttgagacggtcataccacta
ttgcttaatagcgaatccaagccaaaatttgtattttag

DBGET integrated database retrieval system