KEGG   Nitrosococcus oceani: Noc_2642Help
Entry
Noc_2642          CDS       T00281                                 

Definition
(GenBank) Fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
noc  Nitrosococcus oceani
Pathway
noc01040  Biosynthesis of unsaturated fatty acids
noc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Noc_2642
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Noc_2642
Lipid biosynthesis proteins [BR:noc01004]
 Desaturase
  First
   Noc_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: ABA59095
JGI: Noc2642
UniProt: Q3J7V1
Position
complement(2995443..2996612)
Genome map
AA seq 389 aa AA seqDB search
MFSGVLELSFWGYFAVTLVLTHLTIISVTVYLHRHQAHRALELHPAVSHCFRFWLWLTTG
IVTKEWAAVHRKHHAKCETAEDPHSPRTVGIHKVLWQGASLYREAARDPQVTEKYGHGTP
DDWLERNLYTKHSYAGIVLMLFINLGLFGVAGLVIWAVQMHWIPFFAAGVINGLGHYWGY
RNYEVADASTNLLPWGILIGGEELHNNHHAYGSSAKLSSKWYEFDIGWLYIRVLAALKLA
RVKKVAPKLLIQPGKQWVDVDTLRAVVAHRFRLLTAYGREVMAPVLQEEAAHFSGNALYR
RARNWLLRHEALMDAKAQQELSAMLKDNQRLETVYRFRQQLQALWSQAWSSQEALLYALQ
EWCRQAEESGIKALQDFALSLRGYSLQQV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgttttctggagttttagaattgtccttttggggctattttgcggtcacgctggtcctg
acccacctgaccatcatcagtgtgacggtttatcttcaccgccaccaggctcaccgggcg
ctggagttgcatccggcggtgagccactgctttcgtttctggctatggctgaccaccggg
atagtgaccaaggaatgggcggcggtgcaccgtaaacaccatgccaaatgcgagacggcc
gaagacccccatagtcctcggacggtgggtatccacaaagtgctatggcaaggcgcctcg
ctctaccgggaggcggcccgagacccgcaggtaacggagaagtatggccatggcaccccg
gatgattggcttgagcgcaacctctacacgaaacatagctacgcggggattgtgctgatg
ctcttcatcaacctgggcttgtttggtgtagcgggtttagtgatatgggcggttcagatg
cactggattcccttctttgcggcgggggtgattaacggactgggccactactggggctat
cggaactatgaggtggccgatgcctccaccaatctactcccctgggggatattgattggg
ggggaagagctgcacaataaccaccacgcctatggtagttccgccaagctctcttccaag
tggtatgagtttgatatcggctggctctacattcgggtgttggcggcgttgaagctggcc
cgggtgaaaaaggtagcccccaagctgctcatccagcccgggaagcagtgggtggatgtg
gacacgctcagggccgtggtggctcaccgcttccgcctgttgaccgcctatgggcgggag
gtgatggctccggtactccaagaggaggcggctcatttctcaggcaacgcgctgtaccgg
cgggcccgtaactggttgctgcgccatgaggcgttgatggatgccaaggcccagcaggag
ctgagcgccatgctcaaggataatcagcgcctggagacggtgtatcgctttcgccagcag
ctccaggccctctggtcccaggcttggtctagccaggaggcgctattgtatgccctgcag
gagtggtgccgccaggccgaggaatccgggataaaagccttgcaggatttcgccctctcc
ctgcgcggctattctcttcagcaggtttga

DBGET integrated database retrieval system