KEGG   Nitrosococcus oceani: Noc_2662Help
Entry
Noc_2662          CDS       T00281                                 

Gene name
proA
Definition
gamma-glutamyl phosphate reductase (EC:1.2.1.41)
Orthology
K00147  
glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
noc  Nitrosococcus oceani
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:noc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:noc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3016157..3017413)
Genome map
AA seq 418 aa AA seqDB search
MDIKDYMQNLGCRARKVSRVLARAGAEEKNQALEMAASFIEKESQALVEANHKDLAAGRS
KGLDEALLDRLTLTEARIAVMAEGLRQIASLPDPVGAISELSYRPSGIQVGRMRVPLGVI
GIIYESRPNVTADAAGLCLKSGNAVILRGGSEAFHSNQAIACCIHQGLEQAGLPQEAVQV
VETTDRLAVGALITQEEHVDVIIPRGGRSLIERISQEAKIPVIKHLDGICHVYIDDRADL
DKAVAIAVNAKCQRYGVCNAMETLLVAREIAAEILPMMGEHYCSAGVELRGCPETQGLLP
HIEPATEEDWYTEYLAPLLAIRIVAGLDEAIEHITHYGSHHTETIVTEDFTRARRFLTEV
DSSSVMVNASTRFADGFEYGLGAEIGISTDKLHARGPVGLEGLTSQKWIVLGNGHIRE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaagattatatgcagaaccttggctgtcgggctcgtaaagtaagccgagta
ttggcgcgggccggcgcggaggaaaaaaaccaagccttggagatggcagcctcttttata
gagaaggaaagccaagctttagtcgaggccaatcataaggacttagccgcggggaggagc
aaaggactggacgaggctttgctggatcggctgacgttaacagaggcaagaattgccgta
atggccgaggggctacgtcagattgcgtccctgccggaccccgtgggcgcgattagtgag
ctcagctatcggccttcgggtattcaggtagggcgaatgcgagttccccttggcgtgatt
ggaatcatctatgaatcccgccctaatgtcactgcggatgctgccggtttatgcttaaaa
tcgggtaatgcggttatccttcgtggtggttccgaagcttttcattctaatcaagccatt
gcctgttgcatccaccagggactggagcaggcgggattgccacaggaggcagtgcaagtg
gttgaaactaccgaccgtttggcggtcggggcgttgattactcaggaagagcatgtggat
gtgattattccccgggggggtaggagtctgattgagcggattagccaggaggcaaagatt
cctgtcattaagcatctggatgggatttgccatgtttatattgatgaccgggccgatctg
gacaaggcggtggcgattgcagttaatgcaaaatgtcaacgttatggggtttgcaatgcc
atggagactttgttggtagcccgcgagattgccgctgagatattgccaatgatgggggag
cattattgtagtgctggggtggaactgcgcggttgtccggaaactcaaggtttattaccc
catatcgagcccgcgactgaagaagactggtacactgaatatctagccccgctccttgct
attcggatagtggcgggccttgatgaggcgattgagcacattactcactatggctcccac
cataccgaaacaattgtgactgaagattttactcgggcgcggcgtttccttaccgaagta
gattccagctcggtaatggtgaatgcctcgacccgttttgccgatggttttgagtacggc
ctaggcgctgaaattggaatttctaccgataagctccatgcccgtgggccagtaggtctg
gagggattaacctcacagaagtggatcgtattagggaatgggcatatcagggaataa

DBGET integrated database retrieval system