KEGG   Nitrosococcus oceani: Noc_2697Help
Entry
Noc_2697          CDS       T00281                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
noc  Nitrosococcus oceani
Brite
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Noc_2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3055065..3056138
Genome map
AA seq 357 aa AA seqDB search
MFRSHDSYEKAFCYRLLLALSLFSVVASLGAEGGKEPILLEQAKQFFKPLPETMATAEFP
TPPERVSLGKRLFFDPRLSADGMISCATCHRPALYGTDALPRSIGVEHRVNPRNAPTVLN
AALQDWQHWRGDRANVEEQASKSVLGHGSFGNPNEEAVLAKLRALGYTPAFQSAFPEANE
PLTLENFGKAIGAYERTLVSPSPFDNYLKGNTEALGPQAKKGLGIFIKTGCIACHNGVGV
GGQALRKFGIKKNYWQATGSEVVDEGRYSITQNQTDKYVFKVPSLRNVAMTPPYFHDGSV
TTLPKAIRIMAQVQLGKTLSQQQIKAIMVFLNSLTGELPADFQQAPLLPPKAFNALP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttccgttctcatgattcatacgaaaaggctttctgctaccgcctgttacttgcctta
agtctcttttccgtagtggcttccctgggggctgaaggaggcaaggaaccaattttattg
gaacaggcaaagcagttttttaaaccactgccagagaccatggcgacggcagaattcccg
actcctcctgagcgagtaagtttgggtaaacggttatttttcgacccccgcctttctgcc
gatgggatgataagttgcgccacttgccatcggccagccctctatggcaccgatgccctg
ccccgcagtatcggagtggaacatcgcgttaacccccgaaacgccccgacggtcctgaat
gccgctttacaggactggcaacattggcgcggcgatcgggctaatgtagaggagcaggca
tccaaatcggtcctggggcacggaagctttggtaatcctaatgaagaagccgtgcttgcc
aaactgcgcgccttggggtataccccagcatttcaaagcgcttttccagaggcaaacgag
ccactgaccctggagaattttggcaaggctattggcgcctatgaacggaccttagtgagt
ccttcccccttcgataactatctgaaaggaaatactgaagcacttggccctcaggctaag
aaagggcttggtatctttatcaaaacgggctgcattgcttgccataatggcgtaggggta
ggtggtcaggcactgcgtaagttcggcattaaaaaaaattactggcaggcaacgggtagc
gaggtagtggatgaaggccgctacagcatcacccaaaatcaaaccgataagtatgtcttc
aaagtgcccagcttgcggaacgtagccatgactccgccttatttccacgatggttccgtg
accaccttaccgaaagcgatccggataatggcccaggtgcaactcggcaagactctgagc
cagcagcaaattaaagctatcatggtttttctgaatagccttaccggagagttaccagcg
gactttcagcaagcacctttattaccccccaaagctttcaacgctcttccctaa

DBGET integrated database retrieval system