KEGG   Nitrosococcus oceani: Noc_2699Help
Entry
Noc_2699          CDS       T00281                                 

Definition
FAD dependent oxidoreductase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
noc  Nitrosococcus oceani
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Noc_2699
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     Noc_2699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3057751..3059358
Genome map
AA seq 535 aa AA seqDB search
MKLRERHLEKLSQATYDALIIGGGINGATSAAALAGRGAKVALIDKGDFAGFTSQHSSNL
IWGGIKYLETYDFRLVWELCQSRNKLMKYYPSTVKEIRFLATIPEHFRYPRLLPWLGAWL
YWFMGKGFTQPPRLLSQQDIKKEESIIDGERSQGGFEYSDAYLYDNDARFVFNFIRSALN
CGGIAANYVESLGAKSDANKIWRTQARDQISGKEFEIKSKVLINATGPFVDQHNHLTGQK
TPHQHVFSKGVHLIVDQLTPHHRVLAFFASDGRLFFAIPMGARTCIGTTDTHVEAPTTTV
ATEDRQFILDNINRLLALKKPLQVEDIIAERCGVRPLVVATGASGKKDWLELSRKHEIDA
NRDTAHLSIFGGKLTDCLNVGEEVCGLIQTLGISLPHPQHACFGEPPEAVKKAFLQQAEA
IGLDNYTSLETAEKLTCRLWRRYGSEAIRLLANIQADPKQAEVLIKGAEYLRCELQLAAR
NEMIVKLDDFLRRRSKIALMVRRQNLKRSAGLKEACKILFGKQAEEKLAEYFQEN
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacgagaacgccatctggaaaaactgtcccaggccacttacgatgccttgatt
atcggtggcgggattaatggcgcaacctccgccgctgccctcgccggtagaggggctaaa
gtcgccttaattgacaagggggattttgcgggctttaccagccagcactcttctaatctc
atttggggtggaattaaatatttagaaacttacgatttccgattggtatgggaactgtgc
cagtctcgaaataagttaatgaagtattatccttctactgttaaagagattcgtttcctt
gccacgattcctgaacactttagatatccccgtttactcccgtggctaggagcctggctc
tattggttcatgggcaagggatttacccaaccaccccgcctcctatcgcaacaggatatc
aaaaaagaagaaagcattatcgatggggaaaggagccagggtggatttgaatattccgat
gcttatttatatgacaacgatgctcgcttcgtcttcaattttatccgctccgctttaaac
tgtggcggtatcgcggccaattatgtggaatccctcggcgctaaaagcgatgctaataag
atatggagaacccaggccagggatcaaattagcggtaaagaattcgaaatcaaatctaag
gttttgatcaatgccaccggtccctttgtggatcaacataatcatctgactggccaaaaa
acccctcaccagcatgtcttttccaagggagtacacctaatcgtcgatcaactcacgcct
caccatcgagtgctggccttttttgccagtgacgggcgtttattttttgccattcccatg
ggagcaagaacatgtatcggaaccaccgacacccacgtagaagcgcctacgactaccgtc
gcaaccgaagaccgtcaatttattctggataatatcaataggctactcgcccttaaaaag
cccttgcaagtagaagatatcatcgccgagcgttgtggagtcagacccctcgtagttgca
acaggcgcttctgggaaaaaggattggctggagctttcccgaaaacatgaaattgacgcc
aatagagacaccgcccatctcagcatatttgggggaaaactaacggattgcctcaatgtg
ggggaggaggtttgcgggttaatacaaaccctaggaatatctctccctcatcctcaacac
gcttgttttggcgagccaccagaggcagtaaaaaaagcatttctgcagcaggccgaagcc
atcggcttagataactatacttcactagagacggcagaaaaattgacctgccgcctgtgg
cgcaggtatggatcggaagctatccgcttgttagcaaatatccaagccgatcctaagcag
gccgaggtgctcattaagggagcggaatatctccgctgtgaactgcagctagcagcgcga
aatgaaatgattgtcaaactagacgattttctgcgtcggcgctccaaaattgcattgatg
gtgcggcggcaaaatcttaaaagatcagcagggctgaaggaagcctgtaaaattctattt
ggcaaacaagccgaggaaaaattggctgaatattttcaggagaattga

DBGET integrated database retrieval system