KEGG   Nitrosococcus oceani: Noc_2846Help
Entry
Noc_2846          CDS       T00281                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
noc  Nitrosococcus oceani
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_2846
   01230 Biosynthesis of amino acids
    Noc_2846
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_2846
   00030 Pentose phosphate pathway
    Noc_2846
   00051 Fructose and mannose metabolism
    Noc_2846
   00052 Galactose metabolism
    Noc_2846
  Energy metabolism
   00680 Methane metabolism
    Noc_2846
Enzymes [BR:noc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Noc_2846
Protein phosphatases and associated proteins [BR:noc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Noc_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3223288..3224553)
Genome map
AA seq 421 aa AA seqDB search
MAKKNAFYAQSGGVTAVINASACGVIEAARQHPEVIGKVYAGRNGIIGALTEDLIDTSQD
SDNDIAALRHTPGGAFGSCRYKLKGLEENKAEYERLIEVFKAHDIGYFFYNGGGDSQDTA
HKVSQLGDRLGYSIKCIGVPKTVDNDLPLTDNSPGFGSVAKYVAVSVREAALDVASMART
STKVFILEVMGRHAGWIAAAGGLAAEQEGDAPHIILFPEIPFEQGRFLKKVDASVKDYGY
CVVVASEGVRNQEGQFLSETGSRDAFGHAQLGGVAPFIAQMVKERLGYKYHWAVADYLQR
AARHIASRVDVEQAYAVGKAAVEFAIRGKNAVMPTILRASHDPYRWEIGSAHLKDVANVE
KTLPQSYITQEGFGITEEGRSYLAPLIQGEDYPPYKNGLPIYVELKNVPVEKKLKEAFTL
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaagaatgcgttttatgctcaatccggcggcgtgactgcagttatcaatgct
tctgcctgtggtgtcattgaggctgcacggcagcatccggaggttataggcaaagtttat
gctgggcgtaatggcattattggggccttaactgaagatcttatcgataccagccaggac
agtgataatgacattgctgccttacggcatacgccagggggagctttcggatcttgccgt
tataagctcaagggacttgaggaaaacaaggctgagtatgaacgtctgatagaggtgttt
aaggcgcacgatatcggctatttcttttacaatggtggtggcgactctcaggatactgcc
cacaaagtctcccagcttggggatcgactaggatattctattaagtgtattggtgttccc
aagaccgtggataatgatttaccgctcactgataacagtccaggctttggatccgtagca
aaatacgtggcagtctcggtgcgggaagctgctctagatgtggcctccatggctcggact
tcgacgaaagtttttatccttgaggtgatgggacgtcatgcgggttggattgctgctgca
ggcgggttagcagcagagcaggaaggcgatgcccctcatattattttgtttcccgaaatt
ccctttgagcaagggcggttccttaagaaagtggatgccagtgtcaaagattatggctac
tgtgtggtggtggcttcggaaggtgttcgtaaccaggaaggccaatttttatctgaaacc
gggtcgcgggatgctttcggccatgcccagctagggggggtagccccttttattgcccag
atggtgaaagagcggttgggttataaatatcattgggcggttgctgattatttgcagcgg
gcggcacggcatatcgcctcccgggtggatgtggagcaagcctatgcggtgggtaaggct
gctgtggaattcgccatcagaggtaaaaatgcggtgatgcctactatccttcgcgcctct
catgatccctatcgttgggagattggttcagcgcacctaaaggacgtggctaatgtagag
aaaaccctgccccaaagctatatcacccaagaaggttttgggattacggaagaagggcgg
agctatcttgctcccttaattcagggggaagattatcctccctataaaaacgggctgccc
atctatgttgagctcaaaaatgttccagttgagaagaagctcaaggaagcatttacttta
cgctga

DBGET integrated database retrieval system