KEGG   Nitrosococcus oceani: Noc_2994Help
Entry
Noc_2994          CDS       T00281                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
noc  Nitrosococcus oceani
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_2994
   00030 Pentose phosphate pathway
    Noc_2994
   00051 Fructose and mannose metabolism
    Noc_2994
   00052 Galactose metabolism
    Noc_2994
   00500 Starch and sucrose metabolism
    Noc_2994
   00520 Amino sugar and nucleotide sugar metabolism
    Noc_2994
  Nucleotide metabolism
   00230 Purine metabolism
    Noc_2994
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Noc_2994
Enzymes [BR:noc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Noc_2994
    5.4.2.8  phosphomannomutase
     Noc_2994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3387465..3388871
Genome map
AA seq 468 aa AA seqDB search
MKVKEQSLNQSGRIAASIFKAYDIRGVVGETLTPETVYEIGRAIGSEAHAQNQQNIIVGR
DGRLSGPELAHNLIEGIRATGCDVVDIAVVPTPLLYFAAQYLSTGSGVMLTGSHNPPDYN
GMKIMLRGETLALEAIQALRRRIEAEDYARGAGNLQTVDVVPDYIERVTSDVKLTRPLKI
VVDCGNGAAGEVAPRLFRALGGEVSELYCEIDGQFPNHHPDPSQAENLEDLIAKVKAKGA
DLGLAFDGDGDRLGVIDSEGRIIWPDRQLMLYAMDVLSRHPGATILYDIKCSRHLDQVIT
EYGGSPLMWKTGHSLIKAKMRETGALLAGEMSGHIFFKDRWFGFDDALYTGARLLEILAA
DTRTLGEIFAALPNGVSTPELRIEMAEGEHFPFMEKLLHQADFPEAAVTTIDGLRVDFEE
GWGLVRPSNTTPCLVLRFEANDDEALERIEDNFRRLLLEVDPSLVLPF
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaagaacagtcccttaaccagagcggccgtatcgccgcctctatttttaaa
gcctatgatattcgcggtgtggtaggagaaacacttacgccagagaccgtgtatgaaatt
gggcgtgccattggcagcgaggcccatgcgcaaaaccaacaaaatattatcgtaggccga
gatggtcgtctttctggtcccgaattagcccataatcttatcgaaggaattcgggcaacg
ggctgtgacgtggttgacattgctgtggtgccgactccgctgctgtattttgccgcgcaa
tatctaagcaccggctcaggagtgatgctaacaggaagccataatccccctgactataac
ggtatgaaaattatgcttcgcggcgagacgcttgcattagaagctattcaggctctgcgg
cgccgaatcgaagcagaggattatgcccgtggcgcgggtaatctacagacagtagatgtg
gtgcccgattacatcgagcgggtcactagcgatgtgaaacttacccgccccttaaaaatt
gtggtggactgtgggaatggagccgccggcgaagttgcccctcgtctattccgagcgctg
ggtggtgaagtcagcgaattatattgcgagattgacggccaattccctaaccaccacccg
gatccaagtcaggcagaaaatctagaagatttgatcgccaaagtaaaagcaaagggcgca
gatttagggctggcttttgatggcgatggcgatcggttgggggtgattgattctgagggc
cgtattatttggcctgatcgccagctcatgctctatgccatggatgtcctttcccggcac
ccgggggctactatcctttatgatatcaaatgctcccgtcatttagatcaagttattact
gaatatggaggcagcccgctaatgtggaaaacggggcattctcttattaaagccaagatg
agagagactggcgcccttctagcgggtgaaatgagcggtcatatctttttcaaggaccgc
tggtttgggtttgatgacgccctttatacgggagcacgcttattggagattttagccgcc
gatacgcgaaccttgggagaaatatttgctgccttgccgaatggggtaagtacgccagag
ttgcgaatagagatggccgagggagaacattttccgtttatggaaaaattactacaccag
gccgatttcccagaagctgccgtaaccaccatcgatggactgcgcgtggactttgaggag
gggtgggggttggtccgtccttcgaataccacaccttgcttagttttacggtttgaggcc
aatgatgacgaagccctagagcgcattgaagataactttagacgcttgctgctggaagtt
gatcccagcctggtgctgccattctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system