KEGG   Nostoc sp. PCC 7524: Nos7524_0082Help
Entry
Nos7524_0082      CDS       T02363                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Other glycan degradation
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nop00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
95671..98082
Genome map
AA seq 803 aa AA seqDB search
MTTQPSLQIPTCTWNRPIGLGWDKPYTVRYASNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHLFQNIPACQFSVFESHGTSSQAYALATTAPEDGSLQAWQWYPASTATQET
GAYHALYPRSWFVYENVLQAQLTCEQFSPVYAHNYQETSYPVAVFVWKAHNPTNAPITLS
IMLTWQNMTGWFTNALKSPEVKVRDDGSPVYEYQPRLGESQGNYNYLVESPQSLGCFLGR
VGITEPLQEGEGSWCIVTQKHPQVEVFHHTRWNAAGKGDEIWQSFAADGSLPDYIDTTPA
GENEQIGTAIAVRFTLQPGENLEIPFVLAWDFPVTEFAAGVNYHRRYTDFFGTNGNNAWA
IATLALEQYQTWQQQIQAWQQPIIEREDLPNWLKMALFNELYDLTSGGTLWSAATERDPI
GQFAVLECLDYRWYESLDVRLYGSFGLVLLFPELEKSVMRAFARAIPQGDDTPRVIGYYY
TIGAESPVAVRKAVGATPHDLGAPNEHVWQKTNYTSYQDCNLWKDLGCDFVLQVYRDYLF
TGANDVEFLQDCWDAIVQTLDYVKTFDLDGDGIPENSGAPDQTFDDWRLQGVSAYCGGLW
MAALEAAIAISEILSQHQPDSALLKQKSIYATWLEKSLPIYQEKLWNGQYYRLDSNSGSD
VVMADQLCGQFYAALLNLPDIVPGDRAISALRTVYDACFLKFYNGQFGAANGVRPDGSPE
NPQATHPLEVWTGINFGLAAFLVQMGMKDEALRLTEAVVQQIYSNGLQFRTPEAITPSGT
FRASTYLRAMAIWGVYLVMSERV
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaaccctccctgcaaattcccacttgtacttggaatcgtcctataggttta
ggctgggacaaaccttatactgttcgctacgccagtaatattgatgatggcccttggcat
ggtatgcccttgggtggctttggtgctggctgtatcgggcgttcttcgcggggagatttt
aacctgtggcacatcgacggcggtgagcatcttttccaaaatattcccgcctgtcagttc
agtgtgtttgaatctcatggcacatcctcccaagcttacgctttggcgacaacagcaccc
gaagatggtagtctgcaagcttggcaatggtatccagcctctaccgccacacaggaaaca
ggagcatatcacgcgctgtatcctcgtagctggtttgtgtatgagaacgtcttgcaagca
cagttaacctgtgagcaattttcccccgtctatgctcataattaccaagaaactagctac
cctgtggcggtatttgtctggaaggcgcacaacccgacaaatgcacctatcactctcagt
attatgctgacttggcagaatatgacgggctggtttactaatgcgctgaagtctccagag
gtgaaggtgcgggatgatggtagtccggtttatgaatatcagccacgtttaggcgaaagt
cagggtaattacaattatttagtggaaagtccccaatctctaggttgctttttggggcgg
gtaggaattacagaacctttacaggaaggtgagggtagttggtgtattgtcactcagaaa
catccccaagtagaagtgtttcatcatacccgttggaatgctgctggtaagggggatgag
atatggcagagctttgcggcagatggttccttacctgattatattgatactaccccagcc
ggagaaaatgaacagataggaactgcgatcgcagtccgtttcactctccagccaggggaa
aatctggaaattccctttgttctggcttgggatttccccgtgacagaatttgctgctgga
gtgaattatcatcgcagatatacagatttttttggtactaatggtaacaatgcttgggcg
atcgctaccctagctttagaacaatatcaaacttggcaacaacaaattcaagcttggcaa
caacccattatagaacgggaagacttacccaactggttgaaaatggctctatttaatgag
ctgtatgacctcaccagtggtggtacactttggagtgcagccacagagcgcgatcctatt
ggtcagtttgctgtattagagtgtcttgattaccgttggtatgaaagtttagatgtccgc
ttatacggttcatttggactggtgttactgtttccagaactggaaaaatcggtgatgcgt
gcttttgcacgggcaattccccaaggtgatgatacaccccgtgtgattggttattactat
actatcggtgcagaaagtcccgttgctgtgcggaaagctgtcggtgctacaccccatgac
ttaggcgcacccaatgaacacgtttggcagaaaaccaactacaccagttatcaagactgc
aatttgtggaaggatttaggctgtgattttgtcttgcaggtttaccgggattatctgttt
actggtgcgaatgatgttgagtttctgcaagactgctgggatgccattgtgcaaacccta
gattatgtcaaaacctttgatttagatggggatgggattccagaaaactccggcgcacct
gatcaaacctttgatgattggcgattacaaggggtaagcgcctattgtggtggtttatgg
atggcggcgttagaagcagcgatcgctattagtgaaattttaagccaacatcagccagac
tcagcattactcaagcaaaaatctatctatgcaacttggttagaaaaatctttgcctatc
tatcaagaaaaactttggaatggtcaatattatcgtttagatagtaacagtggttctgat
gtggtgatggcagatcaattgtgtggacaattttacgctgctttattaaatttaccggat
attgtgccgggcgatcgcgctatttctgctttaagaactgtgtatgatgcttgtttcctc
aaattttacaatggacaatttggggcggcgaatggtgtgcgtcctgatggttcaccagaa
aaccctcaagctacccatcctctagaagtttggacggggattaattttgggttagcagcg
tttttagtgcagatggggatgaaggatgaagcattacgattaactgaggcggtggtgcag
caaatttatagtaatggtttgcaatttcggacaccggaagctatcactccatctgggact
ttccgcgctagtacctatttacgggcgatggcaatttggggtgtttatttagttatgagt
gagagggtttaa

DBGET integrated database retrieval system