KEGG   Nostoc sp. PCC 7524: Nos7524_0088Help
Entry
Nos7524_0088      CDS       T02363                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7524_0088
Enzymes [BR:nop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Nos7524_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(109411..110262)
Genome map
AA seq 283 aa AA seqDB search
MHSESRKTDLLTASCQLPLYGKRILVTAPRNYASRLSAQIISQGGLPILMPTIETCYLSN
YTDLDQTLKSVDQFDWITFTSRNGIIAFFERMYDLNISISKLQNSQLCALGKDADILLSY
CGKVDVIPKESSPVGIVTELSQIPGISGKKVLVPAPEVIGIPEPNVVPNLVADLQKLGMQ
VTRISTYITQCLDKNIYQLELNLIRQGMIDVIAFSSTAEITSLLTMVESNNDLENCLIAC
FGPYTAANAQQMGIKVDIVSTDFSSFEGFVQAIACVSNKLILQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcactctgaatccagaaaaactgacttgctaactgcatcatgccaactacctttatat
ggcaaaagaatcctagtgacagctcctagaaattatgcttctcggttatctgcacaaatt
atttctcaaggtggattgccaattctcatgcctactatagagacttgttatttatccaac
tatacagatttagatcagactctgaaatccgtagatcaatttgactggattacttttacc
agtagaaatggcattattgctttttttgaacggatgtatgatttaaatatttctatatca
aaattgcaaaatagccaattatgtgcattgggtaaagatgcagatattttattatcttac
tgtggcaaagttgatgtgattcccaaagaatctagcccggtgggaattgtgactgaacta
tctcaaatacctggaattagtggcaaaaaagttttagtacctgctcccgaagttataggt
atacctgaaccaaatgtagttcctaacttagtagcagatttgcaaaaattgggaatgcaa
gtcactcggatatctacatatataactcaatgtttagataaaaatatctaccaattagaa
ttaaatttaattcgtcaaggcatgattgatgtcatcgcctttagtagtacagcagaaatc
accagtttattaacaatggttgaatccaataatgatttagagaattgtcttatagcttgt
tttggcccttatacagctgctaatgcccaacagatgggtataaaagttgatattgtgtca
acagatttcagttcatttgagggatttgtccaggcgatcgcttgtgtgagtaataaactt
atacttcaataa

DBGET integrated database retrieval system