KEGG   Nostoc sp. PCC 7524: Nos7524_0360Help
Entry
Nos7524_0360      CDS       T02363                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nos7524_0360
Enzymes [BR:nop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nos7524_0360
Exosome [BR:nop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nos7524_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(418510..420168)
Genome map
AA seq 552 aa AA seqDB search
MAKPIEFNLFAPHNEGAALIASFSDWQEIPMEKCDDGYFRTTVELEDGTYQYKFRVQTKS
WFFEPDQWVDVTDPYATDIDELSGKDNGVVRIKDGERIVDTYVWQNDDQPLPPDHELVIY
ELHIGDFSGGEDDPYARGKYKHVIEKLDYLCELGINAVELMPIKEYPGDYSWGYNPRYFF
ATESSYGSTADLKHLIDECHQRNIRVIMDGIYNHSEASSPLTQIDHDYWYHHQPRDPDNN
WGPEFNYEHYDESLDTYPARRFIGDTVRFWIQEYHIDGIRYDAARQIANYDFMQWIVQEA
KKAAGAKPFYNIAEHIPETPSITNVDGPMDGCWHDSFYHTVLAHICGDTFDLENLKDVID
CKRQGFMGATNVVNYLTNHDHNHVMVELGNRNILDAEAFKRAKLGAAILMTAVGVPLIWM
GEEFGEYKPKQPDPAKIDWTLLGNDLNRGLFEYYKGLIYLRKNNHALYTENIDFIHDNPD
AKVLAYSRWNDHGSRIVVVVNFSENFLAGYHVPNFPCGGTWHEWTANYDVEAGDDGIITD
IGDYEAKVFVWQ
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcccattgaatttaatttatttgcaccccataatgaaggtgctgccttaatt
gcttctttttccgattggcaagaaattccaatggaaaaatgtgatgatggttattttcgt
acaactgttgaattagaagacggtacttatcaatataaatttcgggtgcagacaaaatca
tggttttttgaacctgaccagtgggtagatgttacagacccttatgccacagatattgat
gaattaagtggtaaagataatggtgtagtgagaatcaaagacggagaaagaattgttgat
acttacgtttggcaaaatgatgatcaacctctaccacctgaccacgaattagttatttat
gaattacacataggagatttttccggtggtgaagatgatccctatgcacgcggtaaatat
aaacacgtcattgaaaagttagattatttatgtgaattaggaatcaatgctgttgagttg
atgccaattaaagaatatcctggtgattatagctggggttataatcctcgctactttttt
gctacagaatccagttatggttccactgctgatttaaaacatttgattgatgagtgccat
cagcgaaatattcgtgtcattatggatgggatttataaccactcagaagcatctagtcca
ctaacacaaattgaccacgattattggtatcaccatcagccgcgtgaccctgataataac
tggggaccggaatttaattacgaacactatgatgagagtttagatacatacccagcccgc
agattcataggtgacacagttcgtttttggattcaagaatatcatattgatggtattcgt
tacgatgcagctagacaaatagctaactatgatttcatgcagtggattgttcaagaagct
aaaaaagctgctggtgctaaacccttttataatattgccgaacacatcccagaaactccc
agcattactaatgtagatgggccaatggatggatgctggcatgatagtttttaccataca
gtcctagcccatatttgcggtgacacctttgatttggaaaacctcaaggatgtaattgac
tgcaaacgtcaaggttttatgggtgcaactaatgttgttaattatttgactaaccatgac
cacaaccatgtgatggttgaactaggtaatcggaatattttggatgcagaagcttttaaa
cgggctaaactaggggctgctattttgatgacagctgttggtgtccctttaatttggatg
ggagaagaatttggcgagtataaacctaagcaaccagacccagctaagattgattggaca
ctgttaggcaatgacctcaatcgtggtttatttgaatactacaaaggcttgatttattta
cgtaaaaataatcacgccctctatacagaaaacattgattttattcacgataatccagac
gctaaggtactagcttacagtcgttggaatgatcatggttcccgtatagttgtggtagta
aatttttcggaaaacttccttgcgggttatcatgttcccaatttcccttgtggtgggaca
tggcatgagtggacagccaattatgatgtcgaagctggtgatgatggtatcataactgac
ataggagattacgaagccaaggtctttgtttggcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system