KEGG   Nostoc sp. PCC 7524: Nos7524_0363Help
Entry
Nos7524_0363      CDS       T02363                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00010  Glycolysis / Gluconeogenesis
nop00071  Fatty acid degradation
nop00350  Tyrosine metabolism
nop00625  Chloroalkane and chloroalkene degradation
nop00626  Naphthalene degradation
nop01100  Metabolic pathways
nop01110  Biosynthesis of secondary metabolites
nop01120  Microbial metabolism in diverse environments
nop01130  Biosynthesis of antibiotics
nop01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_0363
  Lipid metabolism
   00071 Fatty acid degradation
    Nos7524_0363
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nos7524_0363
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nos7524_0363
   00626 Naphthalene degradation
    Nos7524_0363
Enzymes [BR:nop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nos7524_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFY46280
UniProt: K9QKX2
Position
complement(421274..422260)
Genome map
AA seq 328 aa AA seqDB search
MRAMILEAPRQPLRLVDLPIPNYHSEQVLIRVHACAVCRTDLHIVDGELTHPKLPLVLGH
QIVGTVEAIGANVHNFRVGQRVGVPWLGYTCSHCPYCLSGRENLCNYAEFTGYNLDGGYA
EYAVADHRFCFPLDPSYPDLQAAPLLCGGLIGYRAYRMTGDAKKLGFYGFGSSAHILIQL
ARYQNRQVFAFTRTGDITGQEFARQLGATWAGDSNVLPPEPLDAAIIFAPVGKLVPAALR
AVAKGGVVVCAGIHMSDIPSFPYSILWEERVLRSVANLTRRDGEEFLAIAPQIPIYTEIT
AFPLTQANEALDALRSGKIEGSAVLVID
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcaatgattttagaggcaccacgccaaccattacggttagttgacttgcccata
ccaaattatcactccgagcaagtgctgatacgggttcatgcttgcgctgtgtgtcgcacg
gatttgcatatagttgatggggaattgacccacccaaaactacctctggtattaggacat
caaattgttggtactgtagaggcgataggggcaaacgttcataactttcgggttgggcaa
cgggtgggtgtaccttggttggggtatacttgctctcattgtccctattgcctatcaggt
agggaaaatctctgtaattatgctgaatttacaggttataatctagacggtggttatgct
gagtatgctgtagccgaccaccgcttttgctttcctttagaccccagttatcctgactta
caagctgctcctttgttgtgtggaggcttaattggctatcgtgcttacaggatgacaggg
gatgctaaaaaactgggtttttacggttttggttcatcggctcatatcctcatccaacta
gcgcgttatcaaaaccgtcaagtatttgcttttactcggactggtgatattacaggacaa
gaatttgctcgtcaattaggtgcgacttgggcgggtgattccaatgtcttacctccagaa
ccattggatgcagcaatcatttttgcaccggttggcaagcttgtaccagcagctttacgg
gcagttgctaaaggtggtgtagtggtttgtgctggtattcacatgagtgatattccctct
tttccctatagtattctctgggaagaaagggtgttaaggtctgtagctaatttaactcgc
cgagatggagaagaatttttagcgatcgcaccacaaattcccatttatactgaaattaca
gccttccccttaactcaagccaatgaagcattagatgccctacgtagcggtaaaatagag
gggtctgctgttttggtgatagactaa

DBGET integrated database retrieval system