KEGG   Nostoc sp. PCC 7524: Nos7524_0393Help
Entry
Nos7524_0393      CDS       T02363                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nos7524_0393
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Nos7524_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451156..451668)
Genome map
AA seq 170 aa AA seqDB search
MLHQGEITKVRRSALALGSNLGDSVAILAAATQELAAMPGIKLEAKSSWYRTKAVGPPQP
DYINGCVILQVEISPQALLDTLLATEQKFGRVRQQRWGPRSLDLDILLYDDLIIDTPTLQ
IPHPRMHERAFVLVPLVEIAPDWPEPVSGLEIKELVKKVDCSDVHLLKGS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcatcagggagagatcaccaaagtcagacgtagtgccttagccctaggcagtaat
cttggcgattctgtggcaattttagcagcagcaacccaggaattagctgcgatgccaggc
atcaaactagaagcaaaatctagttggtatagaactaaagccgtagggccaccacaacca
gattacattaatggctgtgtgattttgcaagtagaaatcagtccccaggcattattagac
acattgctggcgacagaacaaaaatttgggcgggtacggcaacaacgttgggggccgcga
tcgctggatttagatatactgctgtatgatgatttgattattgataccccaactctgcaa
attccccatccgcgaatgcacgaacgcgcctttgtcttagtgccgttagtcgaaattgcc
cccgattggccagagccagtttccggattagagataaaagaactggtaaaaaaagtagac
tgttctgatgtacatttgttaaagggcagttaa

DBGET integrated database retrieval system