KEGG   Nostoc sp. PCC 7524: Nos7524_0406Help
Entry
Nos7524_0406      CDS       T02363                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nop00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nop00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(467166..468662)
Genome map
AA seq 498 aa AA seqDB search
MKLRELLAAVDGVAQIPSNPALADAEVKGLKTNSHACSVGDLFIGMPGTRVDGGEFWPSA
IASGAVAAIVSPQAVEKNPPNDEAVVISANDMTKACAQIAAAFYGYPGQKLKLVGVTGTN
GKTTTTHLIEFLLTKAQLPTALMGTLYTRWAGFEQTAAHTTPFAVELQQQLAQAVKAGCE
FGVMEVSSHALAQGRVLGCPFEVGVFSNLTQDHLDYHRDMEDYFGAKALLFSPEYLKGRA
IINADDPYGKRLIAALNPAKVWSYSVNDSSADLWMSDLSYEPNGVSGTLHTPEGEVTFRS
PLVGQYNLENLLAAVGAVLHLGLDLQSVAAAIPEFPGVPGRMERVQISPEQDISVIVDYA
HTPDSLENLLKAARPFIPGKMICVFGCGGDRDRTKRPKMGKIAAELADVAVVTSDNPRTE
DPERILEDILGGIPDTIEPMVIGDRATAIRTAILQAQPGDGVLLAGKGHEDYQILGTEKI
HFDDREHARDALQQRSQS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcgggaattactagcagcagtagatggtgtggcacaaatccctagcaatccg
gctttggctgatgctgaagttaaaggattgaaaacgaattcccatgcttgcagtgtggga
gatttgtttattgggatgcctggaacacgggtagatggtggggaattttggccgagtgcg
atcgcttctggtgctgtggctgccattgtttccccccaagctgtcgaaaaaaatcctcct
aatgatgaggctgttgtcattagtgctaacgacatgactaaagcttgcgcccaaattgcg
gcggctttttatggttatcctggacaaaaactcaagctggtaggtgtgactggtactaat
ggtaaaactactactactcacctaatcgagtttctactcactaaagcacaattaccgacg
gctttgatgggaactctctatactcgttgggctggttttgagcaaacagctgcccatacc
acacccttcgctgtggaactgcaacagcagctagcccaagctgttaaggctggttgtgaa
tttggggtaatggaagtcagttcccatgctttagctcaagggcgtgtcctgggttgtccg
tttgaggtgggtgtgtttagtaacctcacccaagatcatctggactatcaccgggatatg
gaagattattttggggctaaagccttattatttagcccggaatatctcaaaggacgggca
attattaatgctgatgatccctacggtaaacgattaattgcggcgttgaatcctgcgaag
gtatggagttacagcgttaacgatagtagtgctgatttatggatgagtgatttaagttat
gagccaaatggtgtcagtgggacactgcatacaccagagggtgaggtaacttttagatcg
cctttagttggtcaatataatttagaaaatctgttagcagccgtaggtgcagttttacat
ctaggattagatttgcaatcagtggcagctgccattcctgagtttcctggtgttccagga
cggatggaaagggtacagattagtcctgagcaagatattagcgtgattgtggattacgcc
cacacaccggatagcttagaaaacttactcaaagcagctaggccttttattcctgggaaa
atgatctgtgtgtttggctgtggtggcgatcgcgatcgcactaaacgccccaaaatgggt
aaaattgcggctgagttagctgatgtggcggtagtaacttctgataatccccggactgaa
gacccagaaaggattttagaggatattttgggcggtatacctgacactatagagccgatg
gtaataggcgatcgcgccaccgctatccgcactgcaattttacaagcccaacccggagac
ggtgtattgctggctggtaaaggtcatgaagactaccaaattctcggtacggagaaaatt
cactttgatgaccgagaacacgcacgggacgcactacaacagcgcagtcaatcttga

DBGET integrated database retrieval system