KEGG   Nostoc sp. PCC 7524: Nos7524_0560Help
Entry
Nos7524_0560      CDS       T02363                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nos7524_0560
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_0560
   00020 Citrate cycle (TCA cycle)
    Nos7524_0560
   00620 Pyruvate metabolism
    Nos7524_0560
Enzymes [BR:nop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nos7524_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645795..647078
Genome map
AA seq 427 aa AA seqDB search
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
VVQAGDSAPVGAAIAYVAETEAEIEAAKSMGNSGGAVATPTSAPEPVAVAASVGTPTLAS
QNGSNHKEGRLVASPRARKLAKDLKVDLTSLKGSGPYGRIVAEDVEAATGKTSTPPAPIT
AVPSITPVKPAAPTPAPAPAATVPGQIAPFNTLQNAVIRNMVASLAVPEFRVSYTITTDG
LDKLYKQIKSKGVTMTALLAKAVAVALQKHPLLNASYSDQGVVYHSDINIAVAVAMDDGG
LITPVLKNADQVDIYSLSRNWKSLVERARAKQLQPDEYNSGTFTLSNLGMFGVDTFDAIL
PPGQGSILAIGAARPQVVASPDGLFGVRQQMQVNITCDHRIIYGAHAAAFLQDLAKLIET
DAQSLTL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaaatattcatgccggcgcttagttccaccatgactgaaggcaaaatt
gtctcctgggtaaaatcgccaggcgacaaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttctatgagggatatctggcacatatc
gtagtacaagccggtgacagtgcgcctgtgggggctgcgatcgcttatgttgcagaaact
gaagccgaaatcgaagccgccaaatctatggggaactccggcggtgcagtagcgactcct
acctctgcacctgaaccagttgcagttgcagcctcagtaggaacacctaccctagcatct
caaaatgggtctaaccacaaagaaggcagactcgtagcttcaccaagggcccgcaaatta
gccaaagacctcaaagttgatttgacctctcttaaaggtagcggcccctacggtcggatt
gtcgctgaggatgtggaagcagctacaggtaaaacttctaccccgcctgctcccattact
gccgtcccaagcattaccccagttaaaccagctgcaccaacacccgcaccagcacccgca
gcaactgtccccggtcaaatcgccccattcaatactctacaaaatgccgtcattcggaat
atggtcgctagcctagcagtaccagaattccgtgttagttacacaatcaccactgatggc
ttagacaaactttacaaacaaattaaatccaagggcgtaacaatgacagccctactggca
aaagccgtagcggtggcattacaaaaacatccacttttaaatgctagctattctgatcaa
ggtgtagtttaccactccgacattaatattgccgtagccgtagctatggatgatggtggt
ttaattacacccgtattaaaaaatgccgaccaagtagacatttactcactctcacgcaat
tggaaatctcttgtagagcgcgctagagctaaacaactgcaacccgacgagtacaacagt
ggtacttttaccctgtctaacttggggatgtttggcgtagatacatttgatgcgattcta
ccaccaggacaaggttcgattttagcgatcggtgcagcccgtccccaagttgtcgccagc
ccagacggtttgtttggtgtgcgtcaacaaatgcaggtaaatatcacctgtgaccaccgg
attatttacggcgcacacgctgcggcgtttttacaagatttggctaagttgattgagact
gatgcccaatctttaacactttaa

DBGET integrated database retrieval system