KEGG   Nostoc sp. PCC 7524: Nos7524_0583Help
Entry
Nos7524_0583      CDS       T02363                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Nos7524_0583
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Nos7524_0583
Exosome [BR:nop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nos7524_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(681104..682621)
Genome map
AA seq 505 aa AA seqDB search
MQTLGSTKSSGYILALDLGTTGNRAFIFNADGKIIGQAYKELTQYYPQPGWLEHDPEVIW
QDTCWVMQTAMSNAQINPSEIAAIGLTVQRETCLLWDKTTGKPLHNAIVWQDRRTAPLCH
QLQQQGYAQEIYDRTGLVIDAYFSATKLRWLLDKITGVDLNNILAGTIDTWVLWQLTGGK
VHATDHSNASRTMLMNLTTCKWDERLLDIFQIPAHILPTIQPSLGEFGVTDTELIGAAIP
ITAILGDQQAALFGHGCDRPGLMKCTYGTGSFLVAHTGSNIVRSQNQLISTVAWTQANDS
NNLDVGYALEGSMFTSGACIQWLRDGIKLIKTAAETETMAEQVPDNGGVYFVPALSGLGA
PYWDMSARGAFFGITAGVQPQHLVRAVLEAIAYQVREIVQAINTSSSNPMQRLIVDGGAC
ENNFLMQLQADVLGIPVERPTMRDTTVQGAAFAAGIAIGFWDSYPQLVNQRQIDRIFEPG
KESDRATANFTTWQKAVKRSLAWEE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcagacattgggtagcacaaaatcatccggctatatcctagcgttagatttaggtaca
acaggcaaccgcgcttttatctttaacgccgatggtaagattatcgggcaggcatataaa
gaactcacacaatactatccccagcccggatggttggaacatgacccggaagttatttgg
caggatacctgttgggtgatgcaaactgccatgtctaacgcccaaatcaacccatcggaa
attgcagccattggtttaactgtacaacgagaaacctgtctactctgggataaaaccaca
ggtaagccattacataatgctattgtctggcaagaccgccgcactgctcccctgtgtcac
caattacaacagcaaggttacgctcaggaaatatacgatcgcactgggttagtaatcgat
gcttatttttctgcaactaaactcagatggcttttagacaagattacaggcgttgattta
aacaatatcctcgctggtacaattgatacttgggtgctgtggcaactcacaggcggaaaa
gtccacgccaccgaccacagcaacgctagccgcaccatgttaatgaatctcacaacctgc
aagtgggatgagagattattagatattttccaaattccggcgcatatcttaccgacaatt
caacccagtttaggagaatttggcgttactgataccgagttaatcggtgcggctatcccc
attacagctattttaggtgatcagcaagcggctttatttggtcacggctgcgatcgcccc
ggtttgatgaaatgtacttacggcactggtagctttttggtggctcatactggtagtaat
attgtgcgttcccaaaatcaactgatttctacagtggcatggacacaagccaatgacagc
aataacttagatgttggctatgccctagaaggcagtatgtttaccagtggcgcttgtatc
caatggttgcgtgatggcatcaagttaatcaaaactgcggcggaaactgaaaccatggcc
gagcaagttcctgataatggtggagtctactttgtccctgccttgagcggactaggcgca
ccttattgggacatgagcgccagaggagcattttttgggattacggctggtgtgcaaccc
cagcatctagtcagggctgtattagaagcgatcgcctatcaagtcagagaaatagtacaa
gcaatcaacacttctagtagcaatcccatgcagcgtttaattgtagacggtggcgcttgt
gagaacaattttctcatgcagttgcaagccgatgtcttaggcattcccgtagaacgccct
accatgcgcgatacaaccgtacaaggtgcagcctttgccgcaggtattgccatcggattt
tgggatagttatccacaactggtaaaccaacgccaaattgatcgcatatttgagccagga
aaagaaagcgatcgcgccacagccaacttcaccacctggcagaaagccgttaaacgctct
ctggcgtgggaggagtag

DBGET integrated database retrieval system