KEGG   Nostoc sp. PCC 7524: Nos7524_0686Help
Entry
Nos7524_0686      CDS       T02363                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nos7524_0686
Enzymes [BR:nop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Nos7524_0686
Peptidases [BR:nop01002]
 Cysteine Peptidases
  Family C44
   Nos7524_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790583..792607
Genome map
AA seq 674 aa AA seqDB search
MSGIVGIYHLDGQPVDSKQLTPMVDVLAHRGPDGSNIWCSESVGLGHRMLWTTPESLLEK
QPLVNQIGDLVLISDLRIDNRDELISALQFDGWASEKITDSQLVLAAYEKWGEQCPEKLL
GDFAFAIWDNRKKVLFCARDHFGIKPLYYFYRPGKHFYFASEIKALLCLPQVPTRLNEVA
IANHLHPFTQDKSITAYQEIFRLPPGHAMTVSYKTGLKTSSYWTLAVGDELKLSSDAEYA
EAFREIFTEAVRCRLRSAFPVSCHLSGGLDSSSIACVARNILQQEKGSQLHTLSNIFDEV
PECDERPYINAVLEQGGLIPHYVNADQSGPISEWQQYFQYIDEPLIGPSHYLVWGLNRAT
QQASIRIALDGFDGDTTVSHGAVYFAELARQGKWATFLVEAQAVSQHFNTSVVAILSEYG
LTYLEELAKQRKWVKFIQTANQISKYFRVSRQKLFVSYGLKNLVPRYILQMWRSLRGYNH
HQNYPNPLINPNLAIRLGVNHSHQPPNNTQMPAVTVREDQWQSLTSPLFTTVLELVDQCA
SAFSMESRHPFMDKRLIEFCLSLPPEQKLNQGWSRIVMRRAMADILPEQVQWRGGKADMT
ANFQRGVRHFDHQLMDKVIMDDPSRIQEFVNLNSLQEFYNQLMYKTEVTNEAAIIPVWKS
VVLALWLSHTQIQP
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtattgtcggtatctaccacctagatggacaaccagtagatagtaaacaattg
acacccatggttgatgttctggcgcatcgggggccagatggatcaaatatatggtgttct
gagtctgttggcttgggacatcgaatgttgtggactactcctgaatctttattagaaaag
caacccctagttaatcaaattggtgatctagttctgatatcagacctacgcatagacaat
cgggatgaattaatctctgcgttacaattcgatggctgggcatcagaaaaaattacagat
agccaattagtgttggcagcttacgaaaaatggggtgaacaatgcccagaaaagttacta
ggagattttgcctttgcaatttgggataacagaaagaaggtattattttgcgccagagat
cattttggcatcaagcctctatattacttttaccgacctggtaagcacttttactttgct
tctgagattaaagcccttttgtgtttaccacaagttcccacaaggctcaacgaagtagcg
atcgccaatcacttacacccttttacccaagataaatctattactgcttatcaagagata
ttccgattaccacccggacacgcgatgacagttagctacaaaacagggttaaagactagc
tcctactggactttagcagtgggtgatgaactaaagttgagttctgatgcagaatacgct
gaagcttttcgggaaatctttacggaagcagtacgttgtcgtttacgtagcgccttccct
gtaagttgccatttaagtggcggactagattcctcatcaattgcctgtgtagcacggaat
atattacagcaagaaaaaggttcacaactgcacaccttatctaatatttttgatgaagtt
cctgaatgtgatgagcgcccctatattaatgcagttttagaacagggtggtttgatccct
cattatgtcaatgcagatcaatccggccccatatcagagtggcagcaatattttcaatat
atagatgaaccattaattgggcctagtcactatttagtatggggtttaaatcgtgctacg
caacaagcaagtatacgaattgctttagatggctttgatggtgatacaactgtgtctcac
ggtgctgtatactttgcggagttagcacgtcaaggtaaatgggctacctttttagtagaa
gctcaagcagtctcccagcatttcaatacctcagttgtggcaattttgagtgaatatggc
ctgacatatctagaagaattggcaaagcagaggaaatgggtaaagtttattcaaactgct
aatcaaattagtaaatattttcgggtttctcgtcagaaattatttgtatcatacggacta
aaaaatttagtaccgcgctacatattacagatgtggcgatcgctgcggggttacaatcac
catcaaaattatcccaatcctttgatcaatcccaacttggcaatcaggctaggtgtgaat
cactctcaccaacctccaaacaatacccaaatgccagcagtgacagtgagagaggatcaa
tggcaaagcctcacctcacccctatttaccacagttctagaacttgtagatcaatgcgct
tcagcattttcgatggagtcacgtcatccttttatggataaacgactgatcgaattttgc
ctatctctaccaccagagcagaagctcaatcagggatggtctcgcatagttatgcgtaga
gctatggcagatattcttcctgaacaagtgcagtggcgtggtggtaaagccgatatgact
gcaaattttcaacgtggagtccgacattttgatcatcaactcatggataaagtgattatg
gatgatcctagtaggattcaagaatttgtgaatctcaattcactacaggaattttataac
cagcttatgtataaaacagaggtgacaaatgaagccgcaataatccccgtttggaaatct
gtcgtactagctctttggctgagtcatacccagatacaaccataa

DBGET integrated database retrieval system