KEGG   Nostoc sp. PCC 7524: Nos7524_1031Help
Entry
Nos7524_1031      CDS       T02363                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00220  Arginine biosynthesis
nop00250  Alanine, aspartate and glutamate metabolism
nop00471  D-Glutamine and D-glutamate metabolism
nop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nos7524_1031
   00220 Arginine biosynthesis
    Nos7524_1031
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Nos7524_1031
Enzymes [BR:nop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Nos7524_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase DUF1811 DUF5461 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AFY46925
UniProt: K9QMT0
Position
1195814..1196788
Genome map
AA seq 324 aa AA seqDB search
MVDTENQGDLEIVPSSLLTVINDLHSQYKSLKEGIVANYIPELAKVNPDLFSICIVTVDG
QVYEVGDYQQLFTIQSISKVFAYGLALEDHGRDYVLTRVGVEPTGEAFNAIILDEQSKRP
YNPMVNAGAIATTSLIKGSGATERLNRLLDMFRRYIGHDVFVDISVFTSERSTGHRNRAM
AHLMLNFGMINQNIEEALDLYFQQCAVMVNCRDLAVMAATLANKGINPITGEQAVDKSYI
KDILSVMYTCGMYNFAGEWAYKVGIPAKSGVCGGIMAVVPHQMGIAVFSPPLDIRGNSVR
GVKVCEELSQRLGLHLFECSGSRE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggtagacacagaaaatcaaggagatttagaaatagttccgtcctcgctgttaaccgta
attaacgacttgcatagtcaatacaagtcattgaaggaagggatagtagcgaactacata
ccagaactggcaaaagtcaacccagatttatttagtatttgtattgtgaccgtagatggt
caagtttacgaagttggggattatcaacagttatttacgatccagtcaatttctaaggtg
tttgcctatggactcgccttagaagatcatggacgagattatgtattgactagggttggt
gtagagccaacgggggaagcatttaatgcgattatcctggatgagcaatcaaagcgacct
tataacccaatggtaaacgcaggagcgatcgccactaccagtttaatcaaaggttctgga
gcaacagaacgcctgaatcgcttactggatatgttccggcgctatattggtcatgatgta
tttgtagatatttccgtctttacgtcggaacgtagcacaggacatcgcaaccgggcaatg
gcgcacttgatgcttaactttggcatgattaaccaaaatattgaagaagccttagacctc
tattttcaacaatgcgctgtcatggtaaactgccgtgacttggcagtgatggcagctact
ttagctaataaaggtatcaaccccataaccggtgaacaagccgtagataaaagttatatc
aaagatattctcagcgtcatgtacacctgcgggatgtataactttgccggtgagtgggct
tacaaagttggtattcccgccaaaagtggtgtttgtggcggcattatggctgtcgtcccc
catcagatgggcattgcagtattttcaccccccttggatatcagaggaaatagtgtcaga
ggggtaaaagtgtgtgaagaactttcccagcgactgggtttacatctatttgagtgttcg
gggagtagggagtag

DBGET integrated database retrieval system