KEGG   Nostoc sp. PCC 7524: Nos7524_1073Help
Entry
Nos7524_1073      CDS       T02363                                 

Definition
magnesium chelatase ATPase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7524_1073
Enzymes [BR:nop01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Nos7524_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1240124..1242163
Genome map
AA seq 679 aa AA seqDB search
MPAPTISPTITSFPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHAL
LPPIEVVTGSISNCDPNHPEEWDDYLAAEYADKQMQDVPTQIIPSPFVQIPLGVTEDRLL
GSVDVEQSVKQGDTVFQPGLLATANRGVLYVDEINLLDDQISNQLLTVLSEGRNQIEREG
ISFQHPCKPLFIATYNPEEGALREHLLDRIAIALSADGVLGLDQRVQAVEQAIAYSKSPQ
DFLQQYSEDIDALKTQIILAREWLKEVTITHEQIAYLVDEAIRGGVQGHRAELFAVRVAK
AAAALDGRATVNAEDLRRAVELVIVPRATVVQTPPPDQPPPPPPPPPQSQDESEQEQQEE
EQEEDKEDQPDEPEEQEPPSIPEEFIFDPEGVILDDSVLYFAQMAQRQGKSGSRSTIFSD
DRGRYIKPMLPKGKVRRIAVDATLRAAAPYQKARRERHPDKKVIVEQGDIRSKRLVRKAG
ALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVALIPFRGEQAEVLLPPTRSIA
LARNRLERLPCGGGSPLAHGLTQAVRIGINAQMSGDVGQVVIVAITDGRGNIPLSRSLGE
PQEPGEKPDIKGELLEIAGRMRALGMQLLVIDTESKFVSTGFAKELAKTSGGKYYHLPKA
TDKAIAAMTKGAIADLKSR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcctactatcagtcccacaattacctcttttcccttgactgctgtagtcggt
caagaagccattaaattagccttgctgctcgcagcagtcgatcctgggttgggaggagta
gcgatcgcaggccgtcgcggtacggcaaaatctgtaatggcgcgtgcgattcatgcctta
ttaccacccatcgaagttgttacaggttcgatcagcaattgcgaccccaaccacccagaa
gaatgggatgactatctggcggcagagtatgccgataaacagatgcaagatgtccccacc
caaatcatcccctcaccttttgtgcagatccccctcggtgtgactgaagaccgtcttctc
ggttctgtggatgtggaacaatctgttaaacaaggggatacagtttttcagcctgggtta
ctcgctaccgctaaccgaggcgtgctgtatgtggatgaaatcaatttattagatgatcag
atatccaatcagctattaacagtcctatcggaaggacgcaaccaaatcgaacgggaaggc
atcagctttcagcatccttgcaaacccttgtttattgcaacctataacccagaagaaggg
gcattacgagaacacttattagatagaattgcgatcgctctgtctgctgacggtgttctc
ggtctagatcaaagggtacaagcagttgagcaagcgatcgcctattctaaatcaccccaa
gattttcttcagcaatacagcgaagatatcgacgcactcaaaacccaaattatcctagcg
cgggagtggttgaaagaagtcaccatcacccacgaacaaattgcttacttagtagatgaa
gccattcgcggcggtgtccaaggacatcgggcggaattatttgcggtgcgcgttgccaaa
gcggctgcggctttagatggcagagccaccgtcaatgcggaagatttgcgccgggctgta
gagttggtaattgtaccacgggccaccgttgtgcagacaccgccaccagaccaaccaccg
ccaccacccccaccccctcctcaaagtcaagacgagtcagaacaagagcaacaagaggaa
gagcaagaagaagacaaagaagatcaaccagacgaaccagaagagcaagaaccccccagc
atccccgaagaatttatcttcgacccagagggagtaatacttgatgatagtgtgctgtac
tttgctcaaatggcacagcgtcaaggtaaatctggtagtcgtagcactatcttttccgat
gatcggggacgctacattaagccgatgttacccaaaggcaaagtccgccgcattgccgta
gatgcgacattaagggcggctgcaccatatcaaaaagcgcggcgtgagagacacccagac
aaaaaagtaattgttgagcagggtgatattcgctcgaagcgcctagtacgtaaagctggg
gcgttagttgtgtttgtagtagatgcttcaggttctatggccttaaaccggatgcagtca
gccaaaggtgcggtgatgcaactgttaacagaagcctatcaaaaccgtgaccaagtggcg
ttgattcctttccggggagaacaagccgaggtgttactaccgccaacccgttctattgct
ttagcaaggaaccgtttagaaagattaccctgtggtggtggttcacccctagctcatggt
ttaacccaagcagtccgcatcggtatcaatgcccaaatgagtggagatgttgggcaagtt
gtgattgtagctatcaccgacggacggggtaatattcccttatcacgttctttaggtgaa
ccacaagaaccaggagaaaaaccagatatcaaaggagaactgctagaaattgctggtagg
atgcgtgctttggggatgcaactattagtgattgatactgagagtaaatttgtctccact
ggctttgctaaagagttagccaaaacatcgggaggtaaatattatcatttgcccaaagcc
accgataaagccattgctgccatgactaaaggtgcgatcgctgatctgaaatctcgatga

DBGET integrated database retrieval system