KEGG   Nostoc sp. PCC 7524: Nos7524_1289Help
Entry
Nos7524_1289      CDS       T02363                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nop00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nop00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1510990..1511994
Genome map
AA seq 334 aa AA seqDB search
MPTSTWNRHHVLSLADFTAGEYDTVLQTAASFQEVLSRRTKKVPALQGQVVANLFFEPST
RTRSSFEIAAKRLSADTLNFAAATSSMTKGETILDTAKTYLAMGTDIMVIRHKEAGVPNA
IAQEMDRLGVKVSVLNAGDGQHEHPSQALLDLFTICSLIDPVNPRLELLNGQKIAIVGDI
LHSRVARSNIWSLIASGAEVHLAAPPTLLPKLFGEYICEEGTEVPPGELFIHWQLEPALE
NADFVMTLRLQKERMTAHLLPSLREYHQLFGITRAKLQLCQPHVKVLHPGPVNRGVEISS
DLMDDPEFSLIQSQVTSGVAVRMALLYLLGSGKI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcctacctccacttggaatcgtcatcacgtcctttctttagctgacttcactgctggt
gaatacgatactgttttacaaacggctgcgagttttcaggaagtgttatcacggcgaaca
aagaaagtaccagctttgcaaggacaggtagtggcaaatttattttttgaaccatctacc
cgcacccgcagtagttttgaaatcgccgccaaacgtctgagtgcagatacactcaacttt
gcagctgctacttcttccatgacgaagggtgaaacaattctcgacaccgcgaaaacctat
ttggccatgggaactgatattatggtgattcgccataaagaagccggagtcccaaatgcg
atcgctcaagaaatggatcgcctaggtgtgaaagttagtgtcctcaatgctggcgatgga
caacatgagcatccttcccaagcactactagatttatttacaatttgtagtctaattgac
ccagttaaccccagactggaattattaaatggtcaaaaaattgccattgtcggggatatt
ctgcattctcgtgtggcacgttctaatatttggagtttaattgccagtggtgcggaagta
catttagctgctccaccgactttgttacctaagttattcggtgagtatatctgtgaggaa
ggaacagaagtacctccaggtgaactatttattcattggcagttagaacccgctttagaa
aatgctgattttgtcatgacgttacgcctacaaaaagaacgtatgactgcccatttatta
ccaagtttgcgagaatatcatcagttatttggcattactcgcgctaagttacaactatgc
cagcctcacgttaaagttttacatccggggccagttaatcggggtgtggaaatcagttca
gatttaatggatgatccggaatttagtttgattcagtcacaagtgacaagtggtgtagct
gtacggatggcattgttgtatttattgggtagtggcaagatttga

DBGET integrated database retrieval system