KEGG   Nostoc sp. PCC 7524: Nos7524_1289Help
Entry
Nos7524_1289      CDS       T02363                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nos7524_1289
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nos7524_1289
Enzymes [BR:nop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Nos7524_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1510990..1511994
Genome map
AA seq 334 aa AA seqDB search
MPTSTWNRHHVLSLADFTAGEYDTVLQTAASFQEVLSRRTKKVPALQGQVVANLFFEPST
RTRSSFEIAAKRLSADTLNFAAATSSMTKGETILDTAKTYLAMGTDIMVIRHKEAGVPNA
IAQEMDRLGVKVSVLNAGDGQHEHPSQALLDLFTICSLIDPVNPRLELLNGQKIAIVGDI
LHSRVARSNIWSLIASGAEVHLAAPPTLLPKLFGEYICEEGTEVPPGELFIHWQLEPALE
NADFVMTLRLQKERMTAHLLPSLREYHQLFGITRAKLQLCQPHVKVLHPGPVNRGVEISS
DLMDDPEFSLIQSQVTSGVAVRMALLYLLGSGKI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcctacctccacttggaatcgtcatcacgtcctttctttagctgacttcactgctggt
gaatacgatactgttttacaaacggctgcgagttttcaggaagtgttatcacggcgaaca
aagaaagtaccagctttgcaaggacaggtagtggcaaatttattttttgaaccatctacc
cgcacccgcagtagttttgaaatcgccgccaaacgtctgagtgcagatacactcaacttt
gcagctgctacttcttccatgacgaagggtgaaacaattctcgacaccgcgaaaacctat
ttggccatgggaactgatattatggtgattcgccataaagaagccggagtcccaaatgcg
atcgctcaagaaatggatcgcctaggtgtgaaagttagtgtcctcaatgctggcgatgga
caacatgagcatccttcccaagcactactagatttatttacaatttgtagtctaattgac
ccagttaaccccagactggaattattaaatggtcaaaaaattgccattgtcggggatatt
ctgcattctcgtgtggcacgttctaatatttggagtttaattgccagtggtgcggaagta
catttagctgctccaccgactttgttacctaagttattcggtgagtatatctgtgaggaa
ggaacagaagtacctccaggtgaactatttattcattggcagttagaacccgctttagaa
aatgctgattttgtcatgacgttacgcctacaaaaagaacgtatgactgcccatttatta
ccaagtttgcgagaatatcatcagttatttggcattactcgcgctaagttacaactatgc
cagcctcacgttaaagttttacatccggggccagttaatcggggtgtggaaatcagttca
gatttaatggatgatccggaatttagtttgattcagtcacaagtgacaagtggtgtagct
gtacggatggcattgttgtatttattgggtagtggcaagatttga

DBGET integrated database retrieval system