KEGG   Nostoc sp. PCC 7524: Nos7524_1438Help
Entry
Nos7524_1438      CDS       T02363                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nos7524_1438
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nos7524_1438
Enzymes [BR:nop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nos7524_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1780902..1781750)
Genome map
AA seq 282 aa AA seqDB search
MMYSVSTSTTYTTRLQPILREVLLQKKQEVAQLHQQMSLASLQRQLTAAPTVRDFLTALQ
QNPHQPSLIAEIQKASPNYGLIRADFDPVAIAQAYERGGAACISVITETSFFQGSYETLR
LLRRRSSLPLLCKEFIIDPCQIYLARAAGADAVLLIAAMLTNRELQDFLRIIHYLGMNAL
VEVHNLAELDRVLKLDDIRLISINNQSLSDFSIDISTTQTLLAARRSHLQNLGVMVVVES
GLYGHAELNLVAQSGANAVLIGESLIKETDIEQAVRHLFNQK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatgtattcagttagcaccagcaccacttataccacccgcctgcaacccattctcaga
gaggttttattgcagaaaaagcaagaagtagctcaactacatcaacagatgtctttagct
tctttgcaacgccagttaactgctgcacccactgtgcgagatttcttaacagctttacag
cagaatcctcatcaacctagcctgattgccgagattcagaaagcatcacctaattatggg
ttaattcgtgccgactttgatcccgtagcgatcgcccaagcctatgaacgaggtggagca
gcttgtatctctgtgattaccgaaacatcattttttcagggtagttatgaaactctccgc
ttgcttcgcagaagaagctcactgccgttattatgtaaagaatttattattgatccctgt
caaatttatctagcacgagccgcaggagcagatgcagttttgctgattgccgccatgctg
acaaatagagaactgcaagattttttacgcataattcattatttggggatgaatgcttta
gtggaggtgcataacttagctgagttggatcgggtactcaagctagatgatattcgctta
atcagcattaacaaccaaagtttatcagattttagcatcgatatcagcaccactcaaacc
ctgttagcagctaggcgatcgcatctgcaaaatttgggtgtgatggtagtcgtggaatcg
ggactgtatggacacgctgaattaaatttagtagctcaatccggtgccaatgctgttttg
attggcgagtcactcattaaggaaacagacattgagcaggctgtacgccatttgttcaac
cagaaataa

DBGET integrated database retrieval system