KEGG   Nostoc sp. PCC 7524: Nos7524_1443Help
Entry
Nos7524_1443      CDS       T02363                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00900  Terpenoid backbone biosynthesis
nop01100  Metabolic pathways
nop01110  Biosynthesis of secondary metabolites
nop01130  Biosynthesis of antibiotics
Module
nop_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nos7524_1443
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Nos7524_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFY47321
UniProt: K9QQ84
Position
complement(1786283..1787332)
Genome map
AA seq 349 aa AA seqDB search
MGRISKLVGSREWGIGSRNIPVSSPQSPVPNTQILMRSYTLIAPAKINLYLEIIGDRPDG
YHELVMILQSIDLADQIELHSISDETIRVHCNHPQVPTDKSNLVYRAAELMAKKFPEALA
KYGGVDITVHKNIPVAAGLAGGSTNAAAVLVGIDLLWNLGLTKSELEELGATLGSDVPFC
VAGGTVIATGRGEQLAPLPSLNHIYIVLAKYRSLEVSTAWAYTTYRQQFGSSYLRNTDDL
AARAAAVHSSAMVKAILDQDATEIAQQLHNDLERVVLPAYPQVLQLRELFAAQAGVLGTM
MSGSGPSVFALCETLEQAEQVKVQIRQAIPDEDLELFVTRTTAQGIHLG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaattagcaaacttgttgggagtagggagtggggaatagggagtagaaacatc
ccagtctccagtccccaatccccagtccccaatacccaaattctcatgcgtagttacacc
cttattgcacctgccaaaatcaatctgtatttggaaatcatcggtgacagaccagatggt
tatcatgagttagtgatgatcctgcaaagtatcgacctcgctgaccaaattgaattacac
tcaattagtgatgaaactatccgcgttcattgcaaccatccccaagtacccacagataaa
agtaatctggtatatcgcgccgccgaactcatggcgaaaaaatttccggaagccttggct
aaatatggcggagtagatattacagtccacaagaatatacctgtagcagctgggttagct
ggcggttccactaatgcagcagccgtgttagtcgggatagatttattgtggaacttggga
ctaactaaatccgaattagaagaactaggtgcaaccctcggctctgacgtaccgttttgc
gtggcaggtggtacagtcatagccacaggcagaggagaacaacttgcaccgcttcctagt
ttgaaccatatatatatagtattggcaaaatatcggagcttagaagtttctaccgcttgg
gcatatacaacctaccgtcaacaatttggtagttcctatctcagaaataccgatgactta
gcagcaagagccgccgccgttcattctagtgcaatggtaaaagccatcttagatcaagat
gccacagaaattgctcaacaattgcacaatgatttagagcgtgtagtattgccagcctat
ccccaagtcttacaactccgagaactatttgcagctcaagcaggtgtgttaggaacaatg
atgtcaggttcaggcccctcagtttttgctctgtgtgaaacattagagcaagcagaacaa
gtaaaggtgcaaatcagacaagccatccccgatgaagatttagaattattcgtaactcgc
acaactgcacagggtattcatttagggtag

DBGET integrated database retrieval system