KEGG   Nostoc sp. PCC 7524: Nos7524_1633Help
Entry
Nos7524_1633      CDS       T02363                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nos7524_1633
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_1633
   00052 Galactose metabolism
    Nos7524_1633
   00500 Starch and sucrose metabolism
    Nos7524_1633
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7524_1633
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nos7524_1633
   00524 Butirosin and neomycin biosynthesis
    Nos7524_1633
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nos7524_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1983410..1984354
Genome map
AA seq 314 aa AA seqDB search
MTAILALDFGGTKLAAAVVNRGSREWLRYQRRFSPADGDVNTDLEIMRSLIHSLLQDVTP
SAIGVSFGGPVDATTGTVRLSHHVPGWENIPLKDLLEQEFGIPTSLDNDANVAALGEYSF
GAGQGYDSLFYITISTGVGGGWILNGKPWRGAAGMAGELGHMVVDPSSPVCLCGKRGCVE
RLASGPYMGQNAKEILATLEPQGGEILRNLVDHNLNSLTGQLISEAATKGDNVAQAVLQK
SAWALGTGIGNVANLMNPQRFILGGSVTKAGENWWNVVQKTARETALPEVMFEIVPAALG
DDAPLWGAVALAEE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcttagccctagattttggtggaactaaactagcagcagcagtagtaaac
cgtggttctagagaatggttgcgttatcagcgtcgtttttccccagccgatggagatgtg
aacaccgacttagaaatcatgcgatcgctcattcattccctactgcaagatgtcactccc
tcagccattggtgtcagttttggcgggcctgtagatgctacaactggcacagtacgatta
tctcatcacgttcctggttgggaaaatattcccctcaaagacttactagaacaagagttt
ggcatacctaccagtctagacaacgatgctaatgttgccgctttgggcgaatacagtttt
ggtgctggtcagggatacgatagcctgttttacattactattagcactggcgtaggtggt
ggttggatacttaatggtaaaccctggcggggtgcagcagggatggctggcgaacttgga
cacatggttgtagatccgagtagccctgtatgtttgtgcggtaaaagaggatgtgtggaa
cgtttagcatcaggcccttacatggggcagaatgccaaggagattttagcaaccctagaa
cctcaaggcggtgaaatattgagaaatttggtagatcataatctcaattcattaacaggt
cagctgattagtgaagctgccaccaagggagataatgtagctcaagcagttttgcaaaag
tctgcttgggcattgggtacaggtattggtaatgtcgctaatctgatgaatccgcagcgt
tttatcttgggcggtagtgtcaccaaagcaggtgaaaactggtggaatgtagtacagaaa
actgccagagaaacagctttaccagaagtgatgtttgaaattgtgccagcagcattaggg
gatgatgcgccattatggggtgctgtagccttggccgaagaatag

DBGET integrated database retrieval system