KEGG   Nostoc sp. PCC 7524: Nos7524_1682Help
Entry
Nos7524_1682      CDS       T02363                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nop  Nostoc sp. PCC 7524
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2040224..2042548)
Genome map
AA seq 774 aa AA seqDB search
MTRLSSPIENLKNHYTVVIVGSGYGGSIAASRLARAGQQVCILERGKEFQPGEYPSNEVK
ALAEMQVDLPHKHLGSRTGLYDFHVNPDINVFVGCGLGGTSLVNANVSLQAEPRVFADQR
WPKALRDDVDTLLAQGYHRAEEMLKPTPYPSNFPALPKLEALEKSSEYLNEKFYRPPINV
TFQDGVNHVGVEQKQCNLCGDCVSGCNHKAKNTVLMNYLPDAKNHGAEIYTQVSVKQIER
QGERWLVHYQILNAGNEKFNAPTMFVSADMVILAAGTLGSTEILLRSQAAGLALSDKLGH
NFTGNGDVLAFAYNNEQVINGVGFGDRPADQREPVGPCITGIIDMREQPQLDNGLVIEEG
SIPGGLARILPQTFAAAARLLGKDTDQGLGDRIGEKMREVESLTRGAYTGAVRNTQTYLV
MTHDDAAGRMYLENDRLRIQWQGVGSQPIFQRVNNRLTEATQPLGGTQIPNPIWTDFFGH
DLVTVHPLGGCILAEDAEQGVVNHKGQVFASNQGTNVYENLYVADGSVIPRTLGVNPLLT
ISAIAERCCALIAQDRGWTINYDLSTVPSLPKTPAKVGIQFTETMRGYFSRTVQDNDYQR
GAQQGKQENSPLDFTITVISDDLDHFLDHPDHPAKVIGTVKAPMLSAEPLTVKNSEFNLF
VVDENQYKTRQMLYRLNMTSQTGQTYYLKGFKHIHDDPGFDVWSDTTTLFITIHDGDSDN
HPVLGQGILKIQPLDFIKQITTLKITNASSVGERLQAVDRFSRFFAGVLSEVYI
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtttatcaagcccaattgaaaatttaaaaaatcactatactgttgtcattgtg
ggttctggctatggtggtagtattgcggcttcgcgccttgcacgggctgggcagcaagta
tgtattttagaacggggcaaagaatttcaaccaggagaataccccagtaacgaagtcaaa
gccttggcagaaatgcaagtagatttaccccataaacacctaggttcgcgtacagggtta
tatgactttcatgtgaatccagatattaacgtcttcgtgggttgtggattgggtggtaca
tccctagttaatgccaacgtatcattacaagctgaaccccgtgtgtttgcagatcaacgc
tggccgaaagcattgcgtgatgatgtcgataccttattagcccaagggtatcatcgggca
gaggaaatgctcaaacctaccccatatccctccaattttccggctttaccaaaactagaa
gctttagaaaagtcttctgaatacttgaatgaaaagttttatcgtccccccatcaatgtg
acattccaagatggagtgaatcatgtcggtgtagaacaaaagcaatgtaatctctgcggt
gattgcgtttcaggttgcaaccataaagccaaaaacaccgtgttgatgaattatctaccg
gatgcgaaaaaccacggggctgaaatttatacccaggtatcagtcaagcaaattgaaaga
caaggtgaacgctggctagttcactaccaaatcctcaatgctggcaacgaaaaatttaac
gcccccaccatgtttgtcagtgccgatatggtgattttggcggctggtacactaggtagc
acagaaattttacttcgttctcaagccgcaggtttagccctgtccgacaaattagggcat
aacttcacaggtaatggcgatgtcttagcctttgcttataacaacgaacaagtaattaac
ggcgttggttttggcgatcgcccagccgatcaacgagaacctgtagggccttgtatcaca
ggcattatcgatatgcgcgaacaaccgcaactagataacggcctagtgattgaagaaggg
tcaattcccggtggactagcgcggatattaccccaaacctttgcagctgctgcccgatta
ctaggtaaagatactgaccaaggtttaggcgatcgcatcggagaaaaaatgcgcgaagtc
gagagtttaactcgtggtgcttacaccggtgcagtccgtaatacccaaacctacctagtc
atgactcacgatgatgcagccggacggatgtatctagaaaatgaccgtctccgcattcaa
tggcagggagtaggcagccaacctatttttcaacgagtcaataatcgcctcacagaagcc
acccaacccctaggcggtacacaaattcccaaccccatctggactgatttctttggtcat
gacctagttacagtccatccattgggcggctgcatcttagccgaggatgccgaacaaggt
gtagtcaaccataaaggacaagtatttgccagcaatcaaggcacaaacgtctacgaaaac
ctctatgttgccgatggttcagtaattccccggacattaggagtaaatccactactaacc
atctccgccatagctgaacgttgttgcgccctaattgcccaagaccgaggctggacaatt
aactatgatttgtctactgtgccgagcctccccaaaacaccagccaaagtgggaattcaa
ttcacagaaaccatgcgtggctacttttcccgcacagtgcaagacaacgactaccaacgg
ggcgcacagcaaggaaaacaagaaaactcaccactagactttaccatcacagtcatctct
gatgatttggatcatttcctcgatcaccccgaccatcctgccaaagtcatcggtacagtg
aaagctcccatgctatcggcagaaccgcttacagtcaaaaacagcgaattcaacctgttt
gttgtggatgaaaaccaatacaaaacacgacaaatgctatatcggttaaatatgacctcc
caaacaggacaaacatattatttaaaaggctttaagcatatccatgatgacccaggattt
gatgtttggtctgataccaccaccttatttatcacaattcatgatggggacagcgacaat
catcccgtcttaggtcaaggcattctcaaaattcagcctttagatttcattaaacaaata
actaccctcaaaattaccaacgcctctagtgtcggggaacgcctgcaagccgtagaccga
ttcagccgcttttttgctggtgtattgtctgaagtttatatctaa

DBGET integrated database retrieval system