KEGG   Nostoc sp. PCC 7524: Nos7524_1761Help
Entry
Nos7524_1761      CDS       T02363                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nos7524_1761
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Nos7524_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2148943..2149878
Genome map
AA seq 311 aa AA seqDB search
MSIIVFGSINIDLVVTAPRLPVAGETLTGEDFLKTPGGKGANQAVALARLGIPTHMVGRV
GAHNFGAELVKHLQDNGVQTQNIFADETVSSGVAIITVDHHGENQIVVIPGANGRVNQED
VGRLSQLLPQAQALLLQLEIPIPAVVAAAQAAHNANIKIILDPAPAQSNLPAELYQLVDI
ITPNEVEAGQLVGFPVDSEDTATKAAEMLLQKGVKSAIVKLGAKGVVCATPEETFFVPAF
EVNAVDSVAAGDAFNSGLAAALYNGLTLHQAVVWGAAAGALAATKLGAQTSLPDRFTFDA
FLGERGVGSGE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagtattatagtctttggcagcatcaatatagacttagtagtaacagccccccgcttg
cccgttgcaggtgaaaccttaaccggagaagactttttaaagactcccggaggtaaaggt
gcaaatcaagcagtagcactagcaagactaggaattcctacccacatggtagggcgtgta
ggcgcacacaattttggtgcagaactggtaaagcatttgcaggataatggtgtacagacg
caaaatatctttgcagatgaaaccgtgagttcaggagtagcaatcatcactgtagatcat
catggtgaaaatcaaatagtggtgattcctggcgctaatggacgtgtcaatcaagaagat
gtagggcgattatcccaactattaccacaagcccaagcactacttttacaactagaaatt
cccatcccagcagtagtagcagccgcccaagctgcacacaatgctaatatcaaaattatt
ttagatcccgctccggcacaatctaatttaccagcagaactttatcagttagtcgatatt
attacacccaacgaagtagaagcaggacaactggtgggttttcctgtagatagcgaagac
acagccacaaaagctgccgagatgttattgcaaaagggagtaaaatctgcgatcgtcaaa
ctaggtgctaaaggcgttgtttgtgccacacccgaagaaaccttttttgtcccagctttt
gaagtgaatgcagttgattctgtagcagccggtgatgcttttaatagcggtttagcagcc
gcactttacaacggactgacattacatcaggctgtagtctggggtgcagccgccggcgct
ttagcagccacaaaattaggcgcacaaacatctttacctgacagatttacatttgatgcc
tttttaggggaaaggggagtggggagtggggagtag

DBGET integrated database retrieval system