KEGG   Nostoc sp. PCC 7524: Nos7524_2023Help
Entry
Nos7524_2023      CDS       T02363                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Nos7524_2023
Enzymes [BR:nop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Nos7524_2023
Transporters [BR:nop02000]
 Other Transporters
  Pores ion channels [TC:1]
   Nos7524_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFY47877
UniProt: K9QSW7
Position
complement(2482032..2482649)
Genome map
AA seq 205 aa AA seqDB search
MIQLYGHELSGNSYKIKLMLSVLGIDYEWIKVDLMARAHKQPEFLALNPFGQVPLLVDGN
TVLADAQAILVYLARQYGGESWLPLEPQAMSRVVRWLSTTAGEIRQGPESARLYHLFKAT
SINLERAIQKSEFILTQLNDHLANQQWLELGHPTIADVAVFPYVALAGDGKIDLTPYTNV
LAWIDRIKHLPGFVGMIGIEAPIAV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattcagctctatggtcacgaattgtctggtaatagctacaaaatcaaactgatgctg
tctgtgttgggtatagactacgagtggatcaaagtcgatttgatggcaagagcgcacaag
caaccggaattcttggcattgaatccttttggacaagtaccactgttagtagacggcaat
acagtgctggccgatgctcaagcaattctggtgtatctggcacggcagtacggtggtgaa
tcatggttgccgttagagccacaagcaatgagccgggtggtgcgttggctttctacaacc
gcaggagagatacggcaaggaccggaatcagcgcgtttataccacttatttaaagctact
agcattaatctagaacgggcaattcaaaaatcagagttcattttgacccaattgaatgac
catttagcgaatcaacaatggctagagttagggcatccgacaatcgccgatgtggcagtc
ttcccctatgtggccttggctggcgatggcaaaatcgacctcactccttataccaacgtg
ttggcttggatagatcgcatcaaacatctccctggtttcgtggggatgattggcattgaa
gcaccaattgcagtctag

DBGET integrated database retrieval system