KEGG   Nostoc sp. PCC 7524: Nos7524_2070Help
Entry
Nos7524_2070      CDS       T02363                                 

Definition
methylase of chemotaxis methyl-accepting protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nop00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nos7524_2070
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Nos7524_2070
Enzymes [BR:nop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Nos7524_2070
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nos7524_2070
Two-component system [BR:nop02022]
 CheA family
  CheA-CheYBV
   Nos7524_2070
Bacterial motility proteins [BR:nop02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Nos7524_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2532238..2536434
Genome map
AA seq 1398 aa AA seqDB search
MNPRPSTKKSQSNSSDESHEQQQELFPIVGIGASAGGLEAFTELLNHLPTDTGMGFVFIQ
HLSPHQTSLLPEILSRTTSMPVLQVQDGMVVEPNHVYVIPPNAMMTISQGILKLTPRQKI
RGQVMSVDKFLISLADDRGSNAIGVVLSGGDADGAKGLDMIKGAGGITFAQCESSARVSS
MPNTAVASGHVDFILTPQQIAAELANISSHPYINHRTSVKAVDIIPESGDALTNIFSLLR
TVTGVDFTHYKQTTLKRRILRRMVLYRLENLQDYVRYLQDHPAEVGALYQDVLITVTSFF
RDPEAFEALKTKVFPVITKERKPDTPIRIWVAGCSTGEEAYSIAICLLEFLSNQVITTSI
QIFATDINDVAIEKARTGIYKASQLADVSPERLQRFFIPVEGGYQISKPVRELCVFARQN
LISDPPFSRLDLITCRNVLIYLGSAVQKKLLPIFHYGLQSNGFLMLGTSETIGEFTDLFT
LVDKKYKIYSRKLAPARLGIDLVSSNYPLQIATSQPPLNKDASDDLEMQKEADRIVLNQY
APVGVVINDDLEILQFRGQTSPYLQPPPGRPSFNLLRMAKEELRIELRTAIHQAKKRGVA
VTKEGIQVKENEQLKQVRINIVPFQSGNSTERYFLVMFADMPSSTTMLLNAGGSNVSSRR
RKKTNNEEENNQLKQELASTKEYLQSIIEEQQATNQDLRAANEEILSSNEELQSTNEELE
TAKEEIQATNEELNTINDELQRRNIESTQITNDLQNFLSSINIPILMLGGDLRIRRFTPA
AETIFNLISSDIGRPISDINHNLNIPDLEAQILEVIRNLNFKTQEVQDHEGHWYDLRIRP
YRTIDNKIDGAVVVLVEIDALKRSTESLTASRDYAQAIVDTMRESLVVLDVNLRVMSANQ
CFYEKFQVIPEDTEQRLIYEIGNGQWDIPLLRSLLEDILPHQSHFQGLEVEHHFEQIGHK
VMCLNARKMVIEDDREMILLVIEDITQQKQLEAERTQLLAQEQSTRNAAEVANRAKDEFL
SILSHELRNPLNSLLGWAQLLQRPQIDDNMMTQGLQAIERSALTQARLINDLLDISRISS
GRLRLDAEPVQLVPIIDAATEVVRISAEAKNIEIVSRLDPAPKTIVGDATRLQQVIWNLL
SNAIKFTPQGGRIDITLDYTDLYAQIQVSDTGKGINADFLPYVFERFRQADGSRTRSNPG
LGLGLSIVHHLVELHGGIIEAASLGEGQGATFTIRLPLQTNLQENAVATPAPVVSPKEPE
LPTDNIPSLEGVRVLVVEDEADIRQLFRIVLEDEGVQVTEAASVQEALAKLTENPGEYDV
MLSDIGLPKEDGYALIRQVRKLSDEVRGQIPAAALTAYAGYAEHQKAVAEGFQMHLAKPV
EPPQLLSVVARLSGRLID
NT seq 4197 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcgcccatctaccaaaaaatctcaatctaactcatctgacgaatcgcatgaa
caacaacaagaattatttcccattgtaggtataggagcttctgcgggaggattagaagca
tttacagaactactcaaccatttgcccactgatacaggcatgggatttgtcttcattcaa
cacttaagtccccatcaaacaagtttattaccggaaattctgtctcgcacaacctcaatg
cctgtattgcaagtacaagatggcatggttgtcgaaccaaatcatgtttatgtgattccc
cccaatgccatgatgacgatttcccaggggatactcaaactcactccgcgtcaaaaaatt
cgcggacaagtgatgagcgttgataaattcttgatatccttagcagatgatcggggtagc
aatgctattggcgtggtactgtcgggtggggatgccgatggcgcaaagggactagacatg
attaaaggggctggtggtattacctttgctcaatgtgagtcatcggcaagagttagtagt
atgcctaatacagctgtagcttctggtcatgtagactttatcttgacaccccaacaaatt
gccgcagaattagccaatattagctctcatccctacattaatcatcgaacgtcagtcaaa
gcagtggatatcatacctgaaagcggagatgccctgacaaatatttttagtttgctacga
acagttaccggggttgactttactcactacaaacaaacaaccttaaagcggcgcatcctg
cggcggatggttttgtatagactagaaaatttacaagactatgtgcgttacctgcaagat
catcccgcagaagttggtgctttatatcaagatgttctcatcactgtcactagctttttc
cgtgatcctgaagcttttgaagctttgaaaaccaaagtatttccagtcatcaccaaagag
agaaaacccgatacacccatccgcatttgggtagcaggatgttctactggtgaagaagcc
tactccatagccatttgtttgctagagtttttaagtaatcaagtcattactacatccatt
cagatttttgctactgatatcaatgatgtagccattgaaaaagcaagaactggcatttac
aaagcgtctcaattagcagatgtttcaccagaaagattacagcgtttctttatcccggta
gaaggtggttatcaaattagtaagcctgtgcgggagttgtgtgtttttgctagacaaaac
ctcattagtgatcctccattttctcgactggatttaatcacttgccgcaacgtgctaatt
tatttgggcagtgcagtacagaaaaagttactgcccatctttcactacggtttacagtca
aatggctttttgatgttaggtacttctgaaaccatcggtgaatttacagacttgtttact
ttggtggacaaaaagtataaaatttattctcgtaagctagctccggctcgactaggaatt
gatttagttagcagtaactaccctctacaaatcgctacctcccaaccaccattgaacaaa
gatgcctcagatgatttagaaatgcagaaagaggctgacaggattgtgttaaatcaatac
gctccagttggtgtagtaattaacgatgatttagaaattttgcaatttcgcggacaaact
agcccttatttgcaaccgcctccaggtagaccgagttttaatttgctacgaatggctaaa
gaagaattacggatagaattacgcaccgctattcatcaagccaaaaaacgcggagtagct
gttaccaaggaaggtatacaagttaaagaaaatgagcagttgaagcaagtaaggattaat
atagtcccatttcagtctggtaacagcacagaacgctactttttagtgatgtttgcagat
atgcctagctcaactacaatgctgttaaatgcaggtggtagcaatgttagctctcggcga
cggaaaaaaaccaataatgaagaagaaaataaccaactcaaacaggaattagccagcact
aaagaatatctgcaatcaattattgaggagcaacaagcgacaaatcaagacctgagagca
gctaacgaagaaatcctctccagtaacgaagaactacaaagtaccaacgaagaactagaa
acagccaaggaagaaattcaagctactaacgaagaacttaacaccatcaacgacgaacta
caacggcgtaatattgaatctactcaaatcactaacgatttacaaaatttcctcagtagt
atcaatattcccattttgatgttagggggtgatttgcggattcgccgctttactcccgca
gccgaaaccatttttaatttgatttccagcgatattggcagaccaattagtgatattaac
cacaatctgaatattcctgatttagaagcacaaattttagaagtaattcgcaatttaaat
tttaaaacccaagaagtgcaagaccacgaagggcattggtatgatttgcgaattagacct
tatcgcacaattgataataaaattgatggtgctgtggtggtgttagtagaaattgatgcc
ctcaaacgcagtacggagagtctcacagcttctagagattatgcccaagcaattgtcgat
accatgcgggaatctttagtagtgttggatgtaaatttacgggtgatgagtgccaatcaa
tgtttttatgaaaaatttcaggtgataccagaagacacagaacaacgcctaatttacgaa
attggcaatgggcaatgggatattcctttattgcgatcgctcctagaagatattctcccc
catcaaagccactttcaaggcctggaagttgagcatcactttgagcaaattggtcacaaa
gtcatgtgtctcaatgctcgcaaaatggtcatagaagacgacagggaaatgattctctta
gttattgaagacatcacccagcaaaaacaattagaagcagaacgcacccaactattagcc
caagaacaatcaacccgcaatgccgcagaagttgccaaccgtgccaaagatgaattttta
tcaattctctcccacgaactgcgtaaccccctcaattctttgttaggttgggcgcagtta
ttgcaaagaccccaaattgacgacaatatgatgactcaggggttgcaagccattgaacgc
agcgcactaactcaagctcgtctcattaatgatctgttagatatctcccgcattagctca
ggtaggctgcgtctagatgccgaaccagttcagttggtaccgataattgacgctgcaact
gaggtagttcgcatctccgccgaagccaaaaacattgaaattgtatcgcggttagatcct
gcacctaaaactatagtaggtgatgccacccgcttacagcaggtaatttggaatttactc
tcaaatgcgattaaattcactccccaaggcggcagaattgacattaccttagactacact
gatctttatgcccagattcaagtgagtgatacaggtaaaggtatcaatgctgactttctt
ccctatgtgtttgagcgattccgtcaagctgatggtagcagaactcgctcaaatcctggt
ttggggctgggattgtcaattgtacaccatttagtagaactccacggcggtataattgag
gcagcaagcctaggagaaggccaaggggcaacttttacaatcaggctacctctgcaaact
aatctacaagaaaatgctgtagccacaccagcgccagtcgtctccccaaaggagccagaa
ttaccaacagataatattccatccctggaaggtgtgcgggtacttgttgttgaagacgaa
gccgatatccgccagttatttagaatcgtgttggaagatgaaggcgtgcaagtaacagaa
gccgcatcagtacaggaagcactagccaagctcacagaaaaccctggtgaatacgatgtc
atgttatctgacattggtttacccaaggaagacggttatgcactgattcgtcaggtgaga
aagttgagtgacgaagttagagggcaaattcccgccgccgccctcaccgcctatgctggc
tatgcagagcatcaaaaagcggtagcagaaggattccaaatgcaccttgctaaaccggtc
gaacctccgcaactgttatctgtagtggctagattgtccggcaggttaattgattaa

DBGET integrated database retrieval system