KEGG   Nostoc sp. PCC 7524: Nos7524_2203Help
Entry
Nos7524_2203      CDS       T02363                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nop00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2690040..2690696
Genome map
AA seq 218 aa AA seqDB search
MLKFYYNPISINARRVWVALLEKQIPFEPCLVSLDGDQFQENFTAINPLQRVPVIVDEVL
RVVESLAILDYLEAKYPTPSLMPSEPQAIATIRMVEMITLNELQPATMLLTRQLVELDTD
TQKLEFAQQRIAAAVQFYENLLGEQTYFAGEDFTLAEVVAGTLIPSLPMFGFSFETYPRL
LAWAERLEARESWQNTTPSMEAVMAAIPNIKAIIERRT
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttttactacaatcccatttctatcaatgcgcgtcgtgtttgggtggcatta
ctggaaaaacaaattccctttgagccatgtctagtaagtctagatggggatcagtttcaa
gaaaacttcacggccattaatcccctccagcgtgtccctgtgatagtggatgaggtattg
cgcgtggtggaatctctggcgattttagattatttagaagcgaagtatcccacgccatcc
ttgatgcctagtgagccgcaagcgatcgctacaattcgtatggtagaaatgattacactc
aatgagttgcaacctgctactatgctattaactcggcaattagtcgagttggacaccgat
actcaaaagttagagtttgcccaacagcgcatagcggcagctgtacagttttacgaaaat
cttttaggagaacaaacttactttgctggcgaagatttcaccctagcagaagtggttgct
gggacattaattccttctttgcccatgtttggcttctcctttgagacgtacccccgttta
ttagcatgggcagaacgactagaagcacgggaaagttggcaaaacactactcccagcatg
gaagctgtgatggctgctatccccaacatcaaggcaattatcgaacgccggacttga

DBGET integrated database retrieval system