KEGG   Nostoc sp. PCC 7524: Nos7524_2435Help
Entry
Nos7524_2435      CDS       T02363                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00010  Glycolysis / Gluconeogenesis
nop00520  Amino sugar and nucleotide sugar metabolism
nop01100  Metabolic pathways
nop01110  Biosynthesis of secondary metabolites
nop01120  Microbial metabolism in diverse environments
nop01130  Biosynthesis of antibiotics
nop01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_2435
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7524_2435
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Nos7524_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase DUF2993 FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFY48277
UniProt: K9QU06
Position
complement(2972761..2973474)
Genome map
AA seq 237 aa AA seqDB search
MVEDNGSIRTLSVDIGGSGVKAMVLDITGNAVTERARVDTPQPATPEVVINAIMVLAAAQ
GEFHRVSVGFPGVVRSGVTETAVNLHSDWIGFDLETALLQRLNKPVRVINDADMQGFGAI
KGKGVELVITLGTGFGSALFVDGKLVPNMEMGHHQFRKNETYEEQLGRATLDRIGQKKWN
RRLEKAIASLQRLFNYDYLYIGGGEAVRVNFQLPLNVRLIPNITGLLGGIALWRDER
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaggataatggttcaattcgcactttatcagttgatattggtggtagtggtgtc
aaagcaatggtgttagatatcacaggtaacgctgtcacagagagggcgcgggttgataca
ccccaacctgcaacaccagaagtagtcatcaatgccatcatggtgttagcggcggctcaa
ggtgagtttcatcgagtttccgtagggtttcctggtgtagtgcgctctggtgtgacggaa
acagcagtaaatttacattccgattggattgggtttgatttagaaacagcactattgcaa
aggttaaataaacctgtacgggtaattaacgatgcagatatgcaagggtttggggcaatt
aaaggtaagggtgtggagttggtaattactttaggtacaggctttggttcggctttgttt
gtcgatgggaaattagtcccgaacatggaaatgggacatcatcagtttcgcaagaatgaa
acttacgaggaacaactaggaagagcaaccttagacagaattgggcagaaaaaatggaat
cgtcgtttagaaaaggcgatcgcatctttgcagaggttgtttaattatgattacctgtat
attggcggcggtgaagccgtcagagtaaattttcagttacctttaaatgtgagactgatt
ccaaatattactgggttattaggtggtatcgctttgtggcgagatgagaggtag

DBGET integrated database retrieval system