KEGG   Nostoc sp. PCC 7524: Nos7524_2435Help
Entry
Nos7524_2435      CDS       T02363                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nos7524_2435
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_2435
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7524_2435
Enzymes [BR:nop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Nos7524_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2972761..2973474)
Genome map
AA seq 237 aa AA seqDB search
MVEDNGSIRTLSVDIGGSGVKAMVLDITGNAVTERARVDTPQPATPEVVINAIMVLAAAQ
GEFHRVSVGFPGVVRSGVTETAVNLHSDWIGFDLETALLQRLNKPVRVINDADMQGFGAI
KGKGVELVITLGTGFGSALFVDGKLVPNMEMGHHQFRKNETYEEQLGRATLDRIGQKKWN
RRLEKAIASLQRLFNYDYLYIGGGEAVRVNFQLPLNVRLIPNITGLLGGIALWRDER
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaggataatggttcaattcgcactttatcagttgatattggtggtagtggtgtc
aaagcaatggtgttagatatcacaggtaacgctgtcacagagagggcgcgggttgataca
ccccaacctgcaacaccagaagtagtcatcaatgccatcatggtgttagcggcggctcaa
ggtgagtttcatcgagtttccgtagggtttcctggtgtagtgcgctctggtgtgacggaa
acagcagtaaatttacattccgattggattgggtttgatttagaaacagcactattgcaa
aggttaaataaacctgtacgggtaattaacgatgcagatatgcaagggtttggggcaatt
aaaggtaagggtgtggagttggtaattactttaggtacaggctttggttcggctttgttt
gtcgatgggaaattagtcccgaacatggaaatgggacatcatcagtttcgcaagaatgaa
acttacgaggaacaactaggaagagcaaccttagacagaattgggcagaaaaaatggaat
cgtcgtttagaaaaggcgatcgcatctttgcagaggttgtttaattatgattacctgtat
attggcggcggtgaagccgtcagagtaaattttcagttacctttaaatgtgagactgatt
ccaaatattactgggttattaggtggtatcgctttgtggcgagatgagaggtag

DBGET integrated database retrieval system