KEGG   Nostoc sp. PCC 7524: Nos7524_2554Help
Entry
Nos7524_2554      CDS       T02363                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nop  Nostoc sp. PCC 7524
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nop00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nos7524_2554
DNA repair and recombination proteins [BR:nop03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Nos7524_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3112486..3113043
Genome map
AA seq 185 aa AA seqDB search
MQRLPGVGPKSAQRLALHILKRPEAEVEALAQALIDAKKQVGLCSVCFHLSAEPVCEICR
NPNRDNQTICVVADSRDVIALEKTREYRGKYHVLGGVISPIDGIGPEQLNVQALVRRVSQ
QKPQEVIMAISPSVEGETTTLYLGQLLKPFTKVTRIAFGLPVGGDLEYADEVTLARALEG
RRELD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgcctacccggagtcggccccaaatctgcccagagattggctttgcatattttg
aagcgtccggaagcggaagtcgaggctttggcgcaagctttgattgatgcgaaaaaacaa
gtgggtttatgttctgtttgttttcatctgtcggctgaacctgtttgtgaaatttgtcgt
aaccccaaccgtgataatcagactatttgtgtagtagctgattcccgtgatgtgattgcg
ctggaaaaaacccgtgagtataggggtaaatatcatgttttgggtggggtgatttctcct
atagatggtattggcccagaacagttgaatgtgcaagctttggtaaggcgggtaagtcag
cagaaaccgcaagaagtgattatggcgattagtcctagtgttgagggggaaactacgaca
ttatatttgggacagttacttaagccatttacgaaggtgacgcgcattgcttttggttta
cctgtgggcggtgatttggaatacgctgatgaggtgactttggcgagggctttggaagga
agaagagagttggattag

DBGET integrated database retrieval system