KEGG   Nostoc sp. PCC 7524: Nos7524_2868Help
Entry
Nos7524_2868      CDS       T02363                                 

Definition
(GenBank) hypothetical protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00270  Cysteine and methionine metabolism
nop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Nos7524_2868
Enzymes [BR:nop01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Nos7524_2868
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Nos7524_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_1 Cupin_2 3-HAO
Motif
Other DBs
NCBI-ProteinID: AFY48685
UniProt: K9QSS6
Position
complement(3483591..3484145)
Genome map
AA seq 184 aa AA seqDB search
MATLLLEDGTIESDLSEIVRELAPLGIYVKHYDPGTSLLFPELLRQEIFTDAEKCYVVDL
HNSVFEFLQQENGYLWSDLWNLHPGLPNLDILITTYSKYHTHTAPESLYVLAGEIIFGFV
KPDGSHVQLLLQSQDYLHIPTAVEHWCSPTALLHCKAVRYFTTADGWVPSYTGTQLSDSH
QKPR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttgttactggaagacggcacaattgagagtgatttaagtgagatagtacgt
gaactagcacctctgggtatctatgtaaaacattacgatcctggcacatcactgttattt
cccgaactcttaagacaggagattttcacagatgccgaaaagtgctatgttgtggatctg
cacaacagtgtgtttgaatttctccaacaggaaaacgggtatctgtggagtgatttgtgg
aatttgcatccagggttgcctaatctcgacatattaatcactacctatagcaagtaccac
actcacactgcacctgaatcactatatgtgctggctggggaaattatttttggcttcgtc
aaacctgatggtagtcatgtacagcttttactccagtctcaagattatttacacatccca
actgcggtagaacattggtgtagtccgactgcgttgttacactgcaaagcagtacgctat
ttcaccaccgcagatggttgggttcccagttatacaggcactcagttgagtgattctcat
caaaagccgcgctaa

DBGET integrated database retrieval system