KEGG   Nostoc sp. PCC 7524: Nos7524_2868Help
Entry
Nos7524_2868      CDS       T02363                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:nop00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3483591..3484145)
Genome map
AA seq 184 aa AA seqDB search
MATLLLEDGTIESDLSEIVRELAPLGIYVKHYDPGTSLLFPELLRQEIFTDAEKCYVVDL
HNSVFEFLQQENGYLWSDLWNLHPGLPNLDILITTYSKYHTHTAPESLYVLAGEIIFGFV
KPDGSHVQLLLQSQDYLHIPTAVEHWCSPTALLHCKAVRYFTTADGWVPSYTGTQLSDSH
QKPR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttgttactggaagacggcacaattgagagtgatttaagtgagatagtacgt
gaactagcacctctgggtatctatgtaaaacattacgatcctggcacatcactgttattt
cccgaactcttaagacaggagattttcacagatgccgaaaagtgctatgttgtggatctg
cacaacagtgtgtttgaatttctccaacaggaaaacgggtatctgtggagtgatttgtgg
aatttgcatccagggttgcctaatctcgacatattaatcactacctatagcaagtaccac
actcacactgcacctgaatcactatatgtgctggctggggaaattatttttggcttcgtc
aaacctgatggtagtcatgtacagcttttactccagtctcaagattatttacacatccca
actgcggtagaacattggtgtagtccgactgcgttgttacactgcaaagcagtacgctat
ttcaccaccgcagatggttgggttcccagttatacaggcactcagttgagtgattctcat
caaaagccgcgctaa

DBGET integrated database retrieval system