KEGG   Nostoc sp. PCC 7524: Nos7524_2942Help
Entry
Nos7524_2942      CDS       T02363                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:nop00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nos7524_2942
Enzymes [BR:nop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nos7524_2942
Two-component system [BR:nop02022]
 CheA family
  WspE-WspRF
   Nos7524_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3566835..3567818
Genome map
AA seq 327 aa AA seqDB search
MRIAIVNDMVMAVESLRRTIAKIPDYDVAWVAYDGAEAVTKCAVDTPDLILMDVLMPNMD
GVEATKHIMKQSPCAIMMVTASVNRYAGQVFEAMSYGALDAINTPIEGSTGLLKKISTIA
KLIDKSPRSRIVNKSHNLPLLIAIGASTGGPQALVTVLSQFPQDFPAAIVIVQHLDAQFT
PNFATWLNEQTPLSVEIASPGSCPQAGKILLAGTNHHLVLRPNLTLEYEQESADCCYHPS
IDVLFKSIVKHWTGKGIGILLTGMGRDGAQGLKMMRDAGWHTITQDSKTSVVYGMPKAAA
ELNAAVEILALEAIASACTRFLSTGQS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgccattgttaacgatatggttatggctgtagagtcgctacggcgtaccatt
gccaaaatcccggactacgatgtggcctgggttgcttatgatggagcagaagctgtgacc
aagtgtgcagtcgatactccggacttaatcttgatggatgtgctgatgccaaatatggat
ggagtcgaagccacgaagcacatcatgaagcaatcaccttgtgcaattatgatggtgact
gccagtgttaaccgttatgctggtcaagtttttgaagccatgtcttatggtgctttagat
gccatcaatacacctattgagggtagtacaggactgctgaaaaaaatctctacgatcgcc
aaactaattgataagtctccccgttccaggatagtcaacaaatcgcataatttaccatta
ttgattgcgattggtgcttctacaggtggcccacaagcattagtaacagttctctcccag
tttcctcaagattttcctgctgcgatcgtcattgtccaacatttagatgctcagtttact
cccaattttgctacttggttaaacgaacaaactcctctatctgtggaaatagccagtcct
ggttcttgtccccaagcaggaaaaattttgctggctggtactaatcatcatcttgtccta
cgtcccaacctgacccttgagtatgagcaagaatctgcggattgttgttaccatccatcg
attgatgtcttgtttaaaagcatagttaaacactggactgggaaaggcataggaattctg
cttacaggtatgggacgggatggcgcacaaggtttgaaaatgatgcgggatgcaggttgg
cataccatcactcaagacagcaaaacttctgtagtttatggtatgcccaaagcggcagca
gaattaaatgcggctgtggagattttagcactggaggcgatcgcctcagcttgtacccgg
tttttatctactggtcaatcctga

DBGET integrated database retrieval system