KEGG   Nostoc sp. PCC 7524: Nos7524_3104Help
Entry
Nos7524_3104      CDS       T02363                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nop02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:nop02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3752463..3753035)
Genome map
AA seq 190 aa AA seqDB search
MSFKIVVIGTSLGGLWALQKILGNLPADFLVPMAIVQHRHKDSDDTLIALLQEYSALPIQ
EVEDKEEILPGQVYIAPADYHLLVEPGHFALSTDQPVSYARPSIDVLFESAADVYGQQVI
GLILTGANQDGKQGLKAVKARGGITIVQEPTTAESAIMPTAAISAVAVDWVVSVLEISPL
LVKLCHSIEN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctttaaaatagtagttattggtacttctttaggaggtttatgggcgctgcaaaaa
attttaggcaatttacctgctgattttttagtgccgatggcgatcgtccaacatcgtcat
aaagattctgatgatactttgatagcactgttacaagaatatagtgctttaccaattcaa
gaagtggaagataaagaagaaatcctcccaggacaggtatatatagcaccagcagattat
catttactcgttgaacctggtcattttgctctttctaccgatcagcctgtttcctatgcc
agaccatcaatagatgtgttatttgaatcagcagctgatgtctatggacaacaagtcatt
ggtttaatattaacaggagcaaatcaagatggtaagcaaggactcaaagcagtcaaagca
cggggaggtattactatcgtacaagagccaactactgctgaaagtgccattatgccaaca
gcagcaatttctgcggttgccgtagactgggttgtgtcagttttagaaatttctccttta
ctggtaaaactttgtcattctatagagaactga

DBGET integrated database retrieval system